PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family ARF
Protein Properties Length: 798aa    MW: 89051.7 Da    PI: 6.905
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006517genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3642.4e-20129243199
                  EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE...............EEETTEEEE-TTHHHHHHHHT--TT- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliy.............rkksgryvltkGWkeFvkangLkegD 78 
                  f+kvlt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+              ++++r++lt+GW+ Fv +++L +gD
  DCAR_006517 129 FCKVLTASDTSTHGGFSVLRKHANEClppldmtQ--ATPTQELVAKDLHGTEWRFKHIFrditsmaesvyktPGQPRRHLLTTGWSTFVTSKRLVAGD 224
                  99****************************9543..445569***************999999999999766666667******************** PP

                  EEEEEE-SSSEE..EEEEE-S CS
           B3  79 fvvFkldgrsefelvvkvfrk 99 
                  ++vF   + +++el+v+v+r+
  DCAR_006517 225 SFVFL--RGENKELRVGVRRH 243
                  *****..3489999*****97 PP

2Auxin_resp98.21.1e-32268347183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+k+ ++vG Rfkm+fe+e+s+err++Gt+vgv+d+++ +W+ SkWrsLk
  DCAR_006517 268 ASHAVATQTLFVVFYKPRT--SQFIIGLNKYLEAVKNGYTVGVRFKMRFEGEESPERRFTGTIVGVEDVSS-QWKCSKWRSLK 347
                  789***************6..9**********************************************888.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-36120271IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-39121257IPR015300DNA-binding pseudobarrel domain
CDDcd100178.59E-18127242No hitNo description
SMARTSM010199.7E-17129244IPR003340B3 DNA binding domain
PROSITE profilePS5086311.223129244IPR003340B3 DNA binding domain
PfamPF023625.0E-18129243IPR003340B3 DNA binding domain
PfamPF065078.1E-31268347IPR010525Auxin response factor
PfamPF023097.0E-8506642IPR033389AUX/IAA domain
SuperFamilySSF542773.14E-13601682No hitNo description
PROSITE profilePS5174527.275606687IPR000270PB1 domain
PfamPF023099.4E-6652690IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 798 aa     Download sequence    Send to blast
MANLGCISQP HLLSQGNNGG MEDMYTELWK ACAGPLVDIP RNGERVYYFP QGHMEQLEAS  60
TNQELNQSIP LFELPNKILC RVVHVQLKAE QETDEVYAQI TLLPEPRQNE PISPDSCHPE  120
PPRTAVHSFC KVLTASDTST HGGFSVLRKH ANECLPPLDM TQATPTQELV AKDLHGTEWR  180
FKHIFRDITS MAESVYKTPG QPRRHLLTTG WSTFVTSKRL VAGDSFVFLR GENKELRVGV  240
RRHAQQQSSM PSSVISSQSM HLGVLATASH AVATQTLFVV FYKPRTSQFI IGLNKYLEAV  300
KNGYTVGVRF KMRFEGEESP ERRFTGTIVG VEDVSSQWKC SKWRSLKVQW DEPASIARPE  360
RVSPWEIEPF VASVPPSLSQ TAPVKNKRPR PPSEISALGK TTVPVIQSNP KRSISIILDS  420
IVHDSCTTGV VEPTSTAVSA AWNPSHDSSQ LNVSLEGQRT DSNVYRQPMQ SAKYSNLTTE  480
SSHVRAPWSK ISDENEDSKS ASAWSVQRSF TNQNPTYQYN EQLPLPVEEK KSDAVTTCRL  540
FGFDLKSSTD AAKKVTPLTP VNVFIKAADG GDSEEKSELS KDSKMKHQGL QVSPKEVQSK  600
QNCSTRSHTK VQMQGIAVGR AVDLSVLRGY DELISELEEM FDIKGQLYPR DQWEIVFTDD  660
EGDMMLMGDD PWQEFCDMVK RILICSSQDV KKMRVGMKLP ISSTDHEVSG FSLDSAISLI  720
ELDRLTKFRS GKATVLGTLV RQPVVFQFFY HLSFSFYLHT VNTISSDYSS NEHNAQGWGT  780
GPLSVKSVKE IAGFDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-175143707355Auxin response factor 1
4ldw_A1e-175143707355Auxin response factor 1
4ldw_B1e-175143707355Auxin response factor 1
4ldx_A1e-174143707355Auxin response factor 1
4ldx_B1e-174143707355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1386390KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017235679.10.0PREDICTED: auxin response factor 9 isoform X2
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A166DU430.0A0A166DU43_DAUCS; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9