PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006285
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 1223aa    MW: 137141 Da    PI: 5.6812
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006285genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.33.1e-28919969252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  e++isl++l++yF++++kdAA ++gvc+T+LKriCRq+GI+RWP+Rkik++
  DCAR_006285 919 ESNISLQVLRQYFAGSLKDAATSIGVCPTTLKRICRQHGISRWPSRKIKKV 969
                  789**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.915903989IPR003035RWP-RK domain
PfamPF020422.0E-24921969IPR003035RWP-RK domain
SuperFamilySSF542774.17E-2111161207No hitNo description
PROSITE profilePS5174523.09111221207IPR000270PB1 domain
SMARTSM006661.7E-2211221207IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.2E-2211221204No hitNo description
CDDcd064072.28E-3511231206No hitNo description
PfamPF005643.0E-1611231206IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1223 aa     Download sequence    Send to blast
MEDGSPLNMF KSVSNNNMDL DLMDGLFDDG CWLEATPSSF WQQSPSPNAS DFSSYFPIVS  60
ANNINHLVPY ANEKDIQDEK EKLNSSNNTR FVYPLLDESD GSEKNRWDAS ASTTQSRSFL  120
VQAGKLNTRL WIAPSADPNP ASSVKNRLIQ AFEYLKNITR DDFLIQIWLP VKREGKIVLS  180
TINQPFSLDP KSKSLECYRY VSSSYHFAAE ENSKEFFGLP GRVFLKKWPE WMPDVHLLRR  240
EDYPRVDYAL QYNVKGSIAL PVFERGNGAC LGVVEIVTTG XQFLSTLSHS ISLNMEDGSP  300
LNMFKSVSNN NMDLDLMDGL FDDGCWLEAT PSSFWQQSPS PNASDFSSYF PIVSANNINH  360
LVPYANEKDI QDEKEKLNSS NNTRFVYPLL DESDGSEKNR WDASASTTQS RSFLVQAGKL  420
NTRLWIAPSA DPNPASSVKN RLIQAFEYLK NITRDDFLIQ IWLPVKREGK IVLSTINQPF  480
SLDPKSKSLE CYRYVSSSYH FAAEENSKEF FGLPGRVFLK KWPEWMPDVH LLRREDYPRV  540
DYALQYNVKG SIALPVFERG NGACLGVVEI VTTGPDVNCL PEVDDVCKAL EAVDLRSSEM  600
FTPAKIMESH ESNLTELTEI KEFLNSVCST YNLPLAQTWA PCNHKDTDQG ENSACLSIVT  660
SAFCVLNEQF LAFHEACCKH HLLKVEGVVG RALGTNQPCF ATDISAFSET EYPFANHAKM  720
LKLKGAVAIR LRSIYTDATD FIIEFLLPLG CKNLEEQKQI VSAILSEIQQ SCSNLRFISD  780
QELEAATDLL PEREEANTSV GKLFKENKHK LVLSSSSEEA TQYEASWISQ MMDSQQKSKG  840
ILVSLGNPKE ESEDELQGKT DWITTTGDLY PGIGHSGHQE VLQDGSGGSV KEVADMSFIK  900
EPRSSGAKKA GQYRRIKAES NISLQVLRQY FAGSLKDAAT SIGVCPTTLK RICRQHGISR  960
WPSRKIKKVG HSLKKLQLVI DSVQGNEGAI QLSSFYNNFP ELNSPNISGI SSLSTFKTDN  1020
HLEPQNQQTG SLLCPATTAS KSTSSSSHST NSSYCCSTEA KEMNANVSAP GELKRALSDV  1080
KFHESGQQDA KFLVRSHSQR VLSSHSPLQN NNNIQAKQNC RAFRVKATFG QEKHRFRMPE  1140
YWRFSDLQEE ISRRFNKDIE DVNKVDLRYL DEDSEWILLT CNDDLEECID IHRSSKARTI  1200
KILLRDARFP NLGSSLDSCG PS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017232227.10.0PREDICTED: protein NLP2-like
TrEMBLA0A166DMT90.0A0A166DMT9_DAUCS; Uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
STRINGXP_009623517.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein