PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 427aa    MW: 47333 Da    PI: 4.5027
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006227genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like811.3e-2567119255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +r+ Wt+e+H++Fvea++qL G+++A Pk+ile m+ +gLt e+v+SHLQkYRl
  DCAR_006227  67 TRVIWTSEMHRKFVEAIAQL-GEDRAFPKKILEEMNEPGLTKENVASHLQKYRL 119
                  799*****************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.08463122IPR017930Myb domain
SuperFamilySSF466891.08E-1864123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-2664123IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2267119IPR006447Myb domain, plants
PfamPF002494.4E-771118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEKLYENDGF AVAGSENGET SNRVNTSFGD EINQTTENRK RKEPEGSSSG EQPDDGDQDD  60
SHVQKRTRVI WTSEMHRKFV EAIAQLGEDR AFPKKILEEM NEPGLTKENV ASHLQKYRLS  120
LKKSLVESDF NADTGSTKTP YIYNSSLGNC QRHYMGTSQI GSRNYLPVST SDHSSLYRIN  180
YTGIGSSGVR LAPPSYSPLN GSFGDHGGEK GDKLLSILNK RRCSNTSDHH ATRSSTSHCA  240
FMGLQFADDG KSLLVGGPKR SEGVPIENYS TNSDFYYQES AAPAFPSFSV EKYAQDSPLP  300
PLPECEDYLE ETTLPLPEFY VENSFPPLED TVTSQPIITN SPWNSNMNMA SDALINHEVS  360
LPPLPSEITW DSYPACTTIN SIPQTMTQHS VLPSESQWNA NNEEQELLLP WSPSEIPWNL  420
DLDPVP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-1964123362ARR10-B
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017233451.10.0PREDICTED: two-component response regulator ARR12-like
RefseqXP_017233816.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLA0A166FGB80.0A0A166FGB8_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.14e-25response regulator 1