PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 373aa    MW: 42840.8 Da    PI: 7.1896
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006080genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.73.1e-24211265155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprlrWtpeLHerF +a e+LGG  +A Pk+il+ m+v g+t+e++kSHLQk R 
  DCAR_006080 211 KPRLRWTPELHERFTRAAEELGGYFEARPKAILQKMNVRGITREQLKSHLQKVRK 265
                  79**************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.915208268IPR017930Myb domain
SuperFamilySSF466892.15E-13209265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-24209266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-19211265IPR006447Myb domain, plants
PfamPF002493.6E-8213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MYSGILMTTS GMYKIHQEQQ HQQQQMRDKN TVVPPGFAPI LPRFGENPYE YFYGQPQSSI  60
HPAYLEHVSV NHTLNDMYKN YQQQQPRDKN TIVPPGFAPI LFGENPYENF HGQLQSSIHP  120
TYLEHVSVNH TLNQGFGVEN HQMMNNTPLY PQGFLYEYSM QQHAMNNSSA TQQTNAPQVE  180
RSSHENDLEV EVESPNALEV EVESPNSPKS KPRLRWTPEL HERFTRAAEE LGGYFEARPK  240
AILQKMNVRG ITREQLKSHL QKVRKSIIHT SSSSGGNLNG QARGRLDFES DVGGHGRLQM  300
SCKCLNNYCE YRIASVNEHL ANNVKFDSKD FCSWKSSRTS TYHQIFRNAT YDSDAHDMKF  360
KDVVFGWIIY IF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017233368.19e-88PREDICTED: uncharacterized protein LOC108207431
TrEMBLA0A162ASG10.0A0A162ASG1_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.34e-16myb-related protein 1