PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_005962
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 484aa    MW: 52876.6 Da    PI: 4.4493
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_005962genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS52.77.9e-17391470183
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                  l++lL++cA+ v++gd + a++ L+++++++s +gd++qRla  f+++L+ar+a++++++y+ l+ ++ +   ++++l+a+++
  DCAR_005962 391 LRTLLISCAQSVAAGDRRTANEQLKQIRQHSSATGDATQRLADLFANGLEARMAGTGTQIYAGLANKKIT---VAQKLKAYEV 470
                  6789**********************************************************99999988...7777777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098513.506365483IPR005202Transcription factor GRAS
PfamPF035142.7E-14391470IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MVMDPGFSDV SEVLKGFGFD NELVSPDCDQ SPDIANGFKF EDETLGLSLS DIPFESPGHV  60
PRSCKPTSGL SLLDIPTNPP DPDLKNATPS TGSSETNSSD DGLFSDGVLK FLNQILMEDK  120
IEEKPCMFHD PLALQAAEKS FYDVIGKEYP ASSQQPVNVN CCLESPDGNF MGSSNVSSSG  180
GNYIGTQWVG DSTYHSTSPN SQSYPQESNM QWSLSSVESF NNSVNDPANL AASTDLIQSI  240
FNDSESILQF NRGMEEASKF LPNSTQLVID LDNYGLPSDK KEIQQEVVKE IEQEVVKVEK  300
DEDSTPTSKG RKHYQRQDSV VYERNKKHSE VYVEEETELL AMFDRVLLCG PPEKKEASEI  360
GPILHENEQP GPKGGKSRSK KKGNTAKEVD LRTLLISCAQ SVAAGDRRTA NEQLKQIRQH  420
SSATGDATQR LADLFANGLE ARMAGTGTQI YAGLANKKIT VAQKLKAYEV VTGYEIESRS  480
PKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017236188.10.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A161X2A30.0A0A161X2A3_DAUCS; Uncharacterized protein
STRINGXP_009606498.11e-109(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.12e-65GRAS family protein