PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_005950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 241aa    MW: 26790.9 Da    PI: 7.0719
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_005950genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.85.9e-29125177255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +rl+Wtp+LH+rFve+v++L G+++A+Pk+i+e+m+v+gL++e+v+SHLQkYRl
  DCAR_005950 125 ARLVWTPQLHKRFVEVVAHL-GIKNAVPKRIMEMMNVEGLSRENVASHLQKYRL 177
                  79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.186121180IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-29122182IPR009057Homeodomain-like
SuperFamilySSF466893.76E-19122181IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-24125177IPR006447Myb domain, plants
PfamPF002491.3E-8127176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MMTDYTGGGY SDDDRVSDWE HGLPNVSDLT PLSQPLIPPE LASAFSITPE PYRTNLDVAR  60
ASQRTMSSLK GQYNNNNNNN NYIQANNWNS SSLDEFPISD PNGDCLRSDP RNSRKLETEV  120
ATKRARLVWT PQLHKRFVEV VAHLGIKNAV PKRIMEMMNV EGLSRENVAS HLQKYRLYLK  180
RMQGLSSEGS SVYDQLFGST PVPQSLREGN GGSMATAYGG QMVAMPGYGQ AGMYHGYDYR  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-31124180157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:21236673, ECO:0000269|PubMed:21753751, ECO:0000269|PubMed:22311777}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:17132630, ECO:0000269|PubMed:21753751}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017234004.11e-180PREDICTED: transcription factor LUX
SwissprotQ9SNB42e-66PCL1_ARATH; Transcription factor LUX
TrEMBLA0A162AS651e-179A0A162AS65_DAUCS; Uncharacterized protein
STRINGVIT_06s0004g05120.t018e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.33e-63G2-like family protein
Publications ? help Back to Top
  1. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]