PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_005866
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 300aa    MW: 34396.6 Da    PI: 6.5074
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_005866genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.44.2e-25144198155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprlrWtpeLHerF +a e+LGG  kA Pk+il+ m+v g+t e++kSHLQk R 
  DCAR_005866 144 KPRLRWTPELHERFTHAAEELGGYFKAKPKAILQKMNVSGITTEQLKSHLQKVRN 198
                  79**************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.567141201IPR017930Myb domain
SuperFamilySSF466891.34E-13142199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-24143199IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-20144198IPR006447Myb domain, plants
PfamPF002491.6E-7146196IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MREKNTIVPP GFSPILPRFG EYVSVNHSPN QDFGFENRQM MDNTPLYPQG CLYEYSVPQH  60
IYPAYHEHVS VNQSLDQGFV FEKHQMTNNT PLYPQGFLYE YSMPPHTMTD SSASHQANAP  120
QEERFTPENV FVVEVESPIL PMSKPRLRWT PELHERFTHA AEELGGYFKA KPKAILQKMN  180
VSGITTEQLK SHLQKVRNSI LRTSSSAGGI LNGQVPSTPS FESDIERHER LQMNSECLNN  240
HCTCRIAPVN EYLANNVKFD LEDFCSLKSS RTSTYHQILK NTMLDRDDRD MKFEHFSFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017233368.11e-133PREDICTED: uncharacterized protein LOC108207431
TrEMBLA0A166DB140.0A0A166DB14_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.17e-17G2-like family protein