PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_005865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 321aa    MW: 36746.2 Da    PI: 6.7278
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_005865genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.96.9e-26165219155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprlrWtpeLHerF +ave+LGG  kA Pk+il+ m+v g+t e++kSHLQk R 
  DCAR_005865 165 KPRLRWTPELHERFTRAVEELGGYFKAKPKAILQKMNVRGITTEQLKSHLQKVRN 219
                  79**************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.976162222IPR017930Myb domain
SuperFamilySSF466893.05E-14163219IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-25164220IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-21165219IPR006447Myb domain, plants
PfamPF002499.5E-9167217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MREKNTIVPP GFSPILPRFD ENLYENFHGQ PQSSIHPAAY HEYVSVNHSP YQDFGFENCQ  60
MMDNTPLYPQ GCLYEYSVPQ HIYPAYNEHV SVNHSLNQGF VFEKHLMTNN TPLYPQGFLY  120
GYSMPQHIMT DSSASHQANA PPEERFSHEN VLVVEVESPI LPMSKPRLRW TPELHERFTR  180
AVEELGGYFK AKPKAILQKM NVRGITTEQL KSHLQKVRNS ILHTSSSAGG ILNGQVPSTP  240
NFESNIERHE RLQMSSECLN NHCSCRIAPV NEHPANNVKF DLEDFCSLKS SQTSTYHQIL  300
RNTMCDRDGR DMKFEHFSFG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14165220257Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017233368.11e-173PREDICTED: uncharacterized protein LOC108207431
TrEMBLA0A166DB000.0A0A166DB00_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.23e-17G2-like family protein