PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_005400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family ARF
Protein Properties Length: 664aa    MW: 74104.1 Da    PI: 6.3875
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_005400genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.42.9e-14111184169
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHH CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFv 69 
                  f+k+lt sd++++g +++ +k+a+e+     + + + +++l+ +d++g +W++k+i+r++++r++lt+GW+ F 
  DCAR_005400 111 FVKILTASDTSTHGGFSVLRKHANEClppldMAQATPTQDLVAKDLHGFEWRFKHIFRGQPRRHLLTTGWSTFL 184
                  89****************************9444455569********************************95 PP

2Auxin_resp99.16.1e-33230309183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a++a++t++ F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+ed +er+++Gt++gv  ++p +W++S+WrsLk
  DCAR_005400 230 ASNAITTHTLFVVFYKPRT--SQFIIRLNKYLEAVSHKYSVGMRFKMKFEGEDPPERSFAGTIIGVGSISP-QWSDSQWRSLK 309
                  6799**************6..9**********************************************999.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.58E-30102230IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-26104218IPR015300DNA-binding pseudobarrel domain
CDDcd100177.04E-12109204No hitNo description
SMARTSM010195.0E-6111206IPR003340B3 DNA binding domain
PfamPF023622.0E-12111184IPR003340B3 DNA binding domain
PfamPF065075.7E-30230309IPR010525Auxin response factor
PfamPF023094.9E-7538586IPR033389AUX/IAA domain
SuperFamilySSF542779.32E-13547626No hitNo description
PROSITE profilePS5174524.865550641IPR000270PB1 domain
PfamPF023091.2E-6593639IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MEKNDLYTEL WRACAGPLVE VPSRGERVYY FPQGHMEQLR ASTNQELDQH IPKFNLPPKI  60
LCHVVHVQLM AEQETDEVYA QITLHPEVEQ AEPTSPDPCV PDPPNPPIHS FVKILTASDT  120
STHGGFSVLR KHANECLPPL DMAQATPTQD LVAKDLHGFE WRFKHIFRGQ PRRHLLTTGW  180
STFLMISSFA LRDDVGELRV GIRRLAGQQS SMPPSVISSL SMHLGVLATA SNAITTHTLF  240
VVFYKPRTSQ FIIRLNKYLE AVSHKYSVGM RFKMKFEGED PPERSFAGTI IGVGSISPQW  300
SDSQWRSLKI QWDEPASIHR PEKVSAWDIE PYTASNSIDL PPPAMKIKRP RPIEIPLTDA  360
TSCAATAPFW YSGSNTTVEH CNLGGAPESE RSESQAVCPP KQKDNNGTCI ISGGLTDGSW  420
KSSMNLFREP VGDKKYVIHP SVMPEYNSAV SSRASNNLFK DQLELDTRTE PSNSCRLFGI  480
DLRNSNIPSP AKEVKDSSAA ADSGKKTFSA AQLEANTAAD LDLNKENEKV LLETIEEENM  540
NKHGTCASKR TRTKVQMQGI AVGRAVDLSL LEGYAELVTE LEKMFEIKGE LKERKKWQVV  600
YTDEEGDMML MGDHPWPEFC TMAKKIFIYT GEEVKRMCPN SKVSSLDGDR RTVSIEPAIK  660
SDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-152433417357Auxin response factor 1
4ldw_A1e-152433417357Auxin response factor 1
4ldw_B1e-152433417357Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1347351KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017232415.10.0PREDICTED: auxin response factor 18-like
RefseqXP_017232416.10.0PREDICTED: auxin response factor 18-like
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A162AQX70.0A0A162AQX7_DAUCS; Auxin response factor
STRINGVIT_15s0046g00290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]