PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 539aa    MW: 60251.8 Da    PI: 5.9035
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004891genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS403.22.5e-1231695382374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++L++cAea+++gd + +  l++ l+ ++s +gdpmqRl ay++e+++ar+++s+s +yk+l+++e +   sse ++++ + +++ P++kf+++  N
  DCAR_004891 169 KQVLVACAEAIADGDVSSVAPLINVLERMVSVTGDPMQRLGAYMMEGIKARMLSSGSIIYKKLKCNEPT---SSELMSYMGVIYQIVPFYKFAYMSSN 263
                  689*****************************************************************9...999999******************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                    I eave e  +HiiDf+i qG QW++L+qaL+sRp+gpp +R+Tgv++++s   +   l+ +gerL+k+Ae++gvpfef+  +a + ++++ e+Lr
  DCAR_004891 264 VIIKEAVEYEPVIHIIDFQIAQGSQWVSLIQALSSRPGGPPIVRVTGVDDSNSAyaRGGGLQLVGERLTKVAESCGVPFEFHG-AAINGSEVKRENLR 360
                  **************************************************988899999************************.899*********** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  +++gEal+Vn+ + lh+++desvs++++rd++L+l+kslsPkvv++veqe+++n+++Fl rf e+l+yy+a+f++++a+ +r++++ri+ E+++++r+
  DCAR_004891 361 IRQGEALVVNFPYVLHHMPDESVSTANHRDRLLRLIKSLSPKVVTLVEQESNTNTSPFLLRFRETLDYYTAMFEAIDASRSRDDRQRISAEEHCVARD 458
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn++aceg+er+erhe ++kW++rl++aG+++ +ls+++   ++ +l+++++  +r+e+++g+l+l Wk+r Lv++SaWr
  DCAR_004891 459 IVNMIACEGEERVERHELFGKWSSRLRMAGYTQCQLSHTVGGVVQDMLKEYSGY-FRLEHRDGALYLRWKNRDLVTCSAWR 538
                  ****************************************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.531142519IPR005202Transcription factor GRAS
PfamPF035148.6E-121169538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MQTFHGSQSS GTTQRLYYQP MQQVEPYWIQ NKKASSDNSS QETAHSSPHD EQFFTLDSSP  60
ADYVTYDSPS VASISSNRSP FSSQYSQSYR SDQHQSPENT YGSPVSGSSM IDDGNALKHI  120
LKELESKLLG PESEADDVCS YSFNSATPEV TSLTKYDRLL QMVPSLDVKQ VLVACAEAIA  180
DGDVSSVAPL INVLERMVSV TGDPMQRLGA YMMEGIKARM LSSGSIIYKK LKCNEPTSSE  240
LMSYMGVIYQ IVPFYKFAYM SSNVIIKEAV EYEPVIHIID FQIAQGSQWV SLIQALSSRP  300
GGPPIVRVTG VDDSNSAYAR GGGLQLVGER LTKVAESCGV PFEFHGAAIN GSEVKRENLR  360
IRQGEALVVN FPYVLHHMPD ESVSTANHRD RLLRLIKSLS PKVVTLVEQE SNTNTSPFLL  420
RFRETLDYYT AMFEAIDASR SRDDRQRISA EEHCVARDIV NMIACEGEER VERHELFGKW  480
SSRLRMAGYT QCQLSHTVGG VVQDMLKEYS GYFRLEHRDG ALYLRWKNRD LVTCSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5517553726378Protein SCARECROW
5b3h_A2e-5517553725377Protein SCARECROW
5b3h_D2e-5517553725377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017236608.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A166CLH20.0A0A166CLH2_DAUCS; Uncharacterized protein
STRINGXP_009625296.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13