PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 415aa    MW: 46959.9 Da    PI: 6.6079
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004389genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK22.32.6e-07321368351
       RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                  ++++++d + y +lp+ +AAk+ +++  +LK  C +     WP+ kik+
  DCAR_004389 321 SQLEMKDFADYLHLPMYAAAKKYDISSRALKNLCDRKSFT-WPYEKIKK 368
                  7899******************************999976.******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.66302389IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MADPNTHVPD HHDPEHNSDE SLGFDFQFSP PSGENIMLDE DVTKLVQERR KKMLNEDVIQ  60
IGLDTSQTGP SGGLNGQSNE DLSGNLNRDF SNFGNPTPLA QWPVPEQPYS CSCCQVLREI  120
IHTIDGESRK FEIHGRVGEI FHGILEICRR DVHPPYKVYQ MFDFCKETIL DIKAFLVQYC  180
EDRTDAGYTM VKDPLLEFNE ALNIGSDWDY DPNADEFSLG SLMDIDDNTG QPPEEPDDSQ  240
PQARRNEKGS KGKGKLVVTE KGSKGKGKLV ANEKGSKGSK GKGKLVVNEA SKKVSKRTKN  300
KAKSIYKEGR RIYKEQRVFT SQLEMKDFAD YLHLPMYAAA KKYDISSRAL KNLCDRKSFT  360
WPYEKIKKCE RQIKRNRAVL NSSVDAKEKR RVEAEIIELE QEIASLLAPT FKDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017254850.13e-67PREDICTED: uncharacterized protein LOC108224673
TrEMBLA0A162B9P90.0A0A162B9P9_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027