PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 407aa    MW: 45045.2 Da    PI: 6.6106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004273genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like49.59.3e-162382672655
      G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  DCAR_004273 238 GATPKSVLELMDVKDLTLAHVKSHLQMYRT 267
                  69***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-14235267IPR009057Homeodomain-like
SuperFamilySSF466893.58E-5238267IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-11238267IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MELFPAQPDL SLQISLPNSS KGASGGGGGW RRTRTEEDKD GMDLGFWKRA LDNSKNSSSS  60
PIFNSSVFSK PSDTNNTAAN SCFDLSLSNP SSASYQKPVN NNIISTQQNF HNLLQNNNNH  120
LLHYTNFNQH NYQQGHQNNI LHNNHHHLYN QNHQYQGGRG LSSDELMGYL KPIRGIPVYQ  180
QQNPPTATTT PYLNFPFVQQ PCSLDSTSSL SSTSPTTPNP SHDSFQSQFD FSFVGLIGAT  240
PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDRAAASSDL FENGSSGDTS EDLMFDNNIQ  300
NPRRSHDDDS SQQGKSKAPH LDKDYQGLWT NSSSSREAWL HGKQIDCGDN NIPSQDQKDM  360
DGKSLSSYER ISEAMSSSNA AETNSTLLFC PKKKPNLEFT LGRPLC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017254399.10.0PREDICTED: probable transcription factor KAN2 isoform X1
TrEMBLA0A166IY620.0A0A166IY62_DAUCS; Uncharacterized protein
STRINGVIT_02s0012g01940.t014e-84(Vitis vinifera)
STRINGPOPTR_0001s02010.16e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-37G2-like family protein