PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 205aa    MW: 22709.5 Da    PI: 7.1278
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004231genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.12.9e-312477255
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 prlrW++eLH++Fv ave+LGG+++AtPk il+lm+vkg+t++hvkSHLQ+YR+
  DCAR_004231 24 PRLRWSEELHKSFVLAVERLGGEDRATPKMILQLMDVKGVTISHVKSHLQMYRS 77
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-302079IPR009057Homeodomain-like
SuperFamilySSF466892.87E-162178IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-242378IPR006447Myb domain, plants
PfamPF002491.7E-62576IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MMSSSQNYIV SATRIRPYVR SKNPRLRWSE ELHKSFVLAV ERLGGEDRAT PKMILQLMDV  60
KGVTISHVKS HLQMYRSMKH EQMIHAAEVE ARRQAAPGTN YFNYSDASDK KVANSMAENF  120
LTPPAWINMY EANWNESCAS EPAFHFNGES VRGFCGNGKE KMLLDTVAGD GGCSASSSNS  180
RGSDMSVTTR DADDISLELT LGFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-182580358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-182580358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-182580358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-182580358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-172580459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017223744.11e-154PREDICTED: transcription repressor KAN1-like
RefseqXP_017223754.11e-154PREDICTED: transcription repressor KAN1-like
TrEMBLA0A166IWV01e-152A0A166IWV0_DAUCS; Uncharacterized protein
STRINGXP_009803423.11e-43(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-29G2-like family protein