PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Dof
Protein Properties Length: 240aa    MW: 27373.9 Da    PI: 7.4317
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004113genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.59.4e-363796261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 + + l+cprC+s+ntkfCyynny+ +qPr+fCkaC+r+WtkGG+lrnvPvGggr++++++
  DCAR_004113 37 QPEPLNCPRCNSSNTKFCYYNNYNRTQPRHFCKACKRHWTKGGTLRNVPVGGGRKNKRHK 96
                 56889************************************************8887775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-233694IPR003851Zinc finger, Dof-type
PfamPF027014.4E-314094IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.4754195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MKQVSDDDSQ VYNNWLPPSE SPKPAQSNKR SHQQLQQPEP LNCPRCNSSN TKFCYYNNYN  60
RTQPRHFCKA CKRHWTKGGT LRNVPVGGGR KNKRHKPSQP AATAATTNPP LQSSYQNINS  120
FHSQQPSFLS NDDSAFIYNS ESFMNHQPMQ FSFSGWNCEK NNRSLNLNNI ATSYQKLENM  180
DKSVINEAWE FEVPGIENNV NSSSVTELGS CSYWNWNEFD STVGDFSIPN WDETEDIKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-29TARGET OF MONOPTEROS 6