PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 386aa    MW: 41799.7 Da    PI: 6.8049
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003998genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.39.5e-15304351653
                  HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                  r+++++kNReAA rsR+RK a++ eLe +v  L+ eN  L  +l el+
  DCAR_003998 304 RQKKMIKNREAAARSRARKHAYTIELEAEVNHLKVENAYLEHRLAELR 351
                  9****************************************9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-10299363IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415301351IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-14304352No hitNo description
PfamPF001701.3E-12304351IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11304352No hitNo description
PROSITE patternPS000360306321IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MSHQQDLNSG EGKKNPGIDI MVDQSEDEVE SALRMKDGKQ PRSNAFPSPI SQSSGYLQAL  60
DEFENALTGS GRNYGSMNMD EFLQGIWSTE GNIIQAQNSD IAMPDVVPII SASNNNPLYP  120
SCETSNERGN TAGQMSLKRQ GSLIVPPPLG QIRTVEEVWS EINRTQQSIN SHDGSEKSYP  180
ANEKLTLEDF LVRAGVVREA SGRQAQPPPP PLPPQLPQLQ PQPLFQIASG IQIGGDNLAA  240
CFPGGIGSVS ANQLAYSVYG GGVTDNGYGA QSSENMSHVS SDGIGMSQLG RKRNGPGKKV  300
IENRQKKMIK NREAAARSRA RKHAYTIELE AEVNHLKVEN AYLEHRLAEL RTGPMKQYAE  360
ADKAEAQARA KAKLGILRRS LSSTF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017229205.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1
TrEMBLA0A166IPB00.0A0A166IPB0_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61552433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.14e-46bZIP family protein