PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family B3
Protein Properties Length: 491aa    MW: 55526.9 Da    PI: 9.7113
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003877genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.52.4e-1373162298
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  fk+ +  +v+++  l lp++f++ ++++   +  ++l+ + g +W v l  ++++ +++l++GW +F++   +  g  +vF+++g+s+f   v +f+
  DCAR_003877  73 FKIIL-TNVGSHTKLQLPREFLRIFSKN--LKDSIMLNVPGGLEWPVDL--ERQKAKVWLQNGWPKFADCYSISFGYLLVFEYMGDSKF--QVFIFD 162
                  55553.46888888********666544..5558***************..**********************************9999..666665 PP

2B348.71.4e-152793591698
                  EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +++pk+f ++++  k +s +  + d +g+sW v ++ + + +++ +++GW  F+++n L +gD++vF+l++rs+++++v + r
  DCAR_003877 279 VYIPKTFKDAYK--KWQSNEKLILDVEGNSWIVSCNLNLNCRQCRISRGWTIFARENSLVVGDVCVFELINRSSKRFKVFISR 359
                  79*****98886..5677788899**********************************************9988877776655 PP

3B345.91e-14397488198
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  ff+v ++  +l  g +++p +f++++   +++s  + l+ ++g++W+vk+ +r k     +++GWk+F  +n+L +gD++ F+l++ ++  l+v +fr
  DCAR_003877 397 FFTVKVHRCYLYGGSMTVPMDFINKYI--TRGSCSIDLQLPDGKVWSVKCYIRDKC--AKFSAGWKNFSIENKLAAGDICGFELVN-KSL-LKVAIFR 488
                  677777777888899********8884..4566789999***********334444..45899********************987.444.6888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.3004.4E-52658IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF1019361.35E-1868164IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.5E-1869164IPR015300DNA-binding pseudobarrel domain
CDDcd100171.04E-1171162No hitNo description
PROSITE profilePS5086312.99971164IPR003340B3 DNA binding domain
SMARTSM010191.2E-1172164IPR003340B3 DNA binding domain
PfamPF023621.7E-1173161IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-18254360IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-18257360IPR015300DNA-binding pseudobarrel domain
CDDcd100171.29E-17260359No hitNo description
SMARTSM010195.5E-8262359IPR003340B3 DNA binding domain
PfamPF023623.6E-14278358IPR003340B3 DNA binding domain
PROSITE profilePS5086311.928279361IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-21390488IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-23391488IPR015300DNA-binding pseudobarrel domain
CDDcd100172.38E-17396488No hitNo description
SMARTSM010195.8E-14397490IPR003340B3 DNA binding domain
PfamPF023621.0E-13397488IPR003340B3 DNA binding domain
PROSITE profilePS5086313.183397490IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MLSTRAVKYL RALILLPTQD LALQELQSSV DILVAAPGRL MDHINNTKGF TLEHLHYLLS  60
WADMMPGKPN RFFKIILTNV GSHTKLQLPR EFLRIFSKNL KDSIMLNVPG GLEWPVDLER  120
QKAKVWLQNG WPKFADCYSI SFGYLLVFEY MGDSKFQVFI FDPSSLEIDY PLASNDKPDA  180
VKSAQVKRRL IDIDESETSD NSSSSDDSSS SDYAVRYCKK KKAKSTSSEE SANLGLEKAP  240
TEVQKDRATA VANAFKSKNP FFVHAMKASH IVGGGWPNVY IPKTFKDAYK KWQSNEKLIL  300
DVEGNSWIVS CNLNLNCRQC RISRGWTIFA RENSLVVGDV CVFELINRSS KRFKVFISRA  360
AKETNDEGNK RLARVRSEAE RARVLESVEA YKPNRPFFTV KVHRCYLYGG SMTVPMDFIN  420
KYITRGSCSI DLQLPDGKVW SVKCYIRDKC AKFSAGWKNF SIENKLAAGD ICGFELVNKS  480
LLKVAIFRVG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1937448925142B3 domain-containing transcription factor VRN
4i1k_B2e-1937448925142B3 domain-containing transcription factor VRN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-20B3 family protein