PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003837
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family B3
Protein Properties Length: 762aa    MW: 86943.1 Da    PI: 10.0349
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003837genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3331.1e-109683699
                 EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                 ++l+ ++g  W+v+l  + + g ++l++GW eF++   +k g  ++Fk+ g+sef  +v++f++
  DCAR_003837  9 ISLKVPNGLAWRVTL--KTRNGDVWLKNGWTEFARFYSVKFGHLLIFKYRGHSEF--KVRIFDS 68
                 88999**********..888888**************************999999..9999987 PP

2B353.83.5e-171772611199
                  HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +k + lv+ k f e++++   ++ + +  + +g++W v +  + k++++ l++GW +Fv++n L +gD++vF+l++++++ l v +fr+
  DCAR_003837 177 GKGRGLVIKKAFEESYKKW--KDNDQVHLQVEGKKWLVHC--DMKQDSCRLSSGWDKFVQDNSLTVGDVCVFELVDERRRLLQVVIFRA 261
                  3446699999999999644..33345556679********..99999999*************************98888799999986 PP

3B352.59.1e-17300379386
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                  k+ + ++ l  + l++p+kf++++  +      +tle+++g++W vk+  + + +++ ++ GWk+F++an+L +gD++ F+l++
  DCAR_003837 300 KAKVCPSCLYGASLTVPRKFIKKYITE--DCCHVTLENSDGETWLVKC--SAYESGTKFGVGWKQFARANQLAVGDVCAFELIN 379
                  5555667777788**********9433..3458***************..99999999***********************874 PP

4B348.41.7e-153834601699
                  EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                   ++p+kf+++hg+k   +  ++l+ ++g +W+v+l  ++  ++++l++GW +F+k   ++ g  + Fk+ g+ +f  +v++f+ 
  DCAR_003837 383 KMIPRKFVRKHGNK--LGSRISLKAPNGLVWKVNL--ERDENEVWLQDGWPQFAKFYSIQFGHLLFFKYRGHCDF--KVRIFDP 460
                  58*********977..5669***************..********************************999999..9999986 PP

5B350.53.6e-16535624799
                  .-HH.HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   7 psdv.lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                   s+v +k++ lvl+k f e++++   ++ + +  +  gr W v++i++ +++r  l++GW +F+++n L +gD++vF+l+++ ++ l v++f++
  DCAR_003837 535 ISHVdGKRRGLVLSKAFEETYKKW--KDNDQVHLQVAGRIWPVNCIMKWNRCR--LGSGWDRFAQDNSLSVGDVCVFELINTCTKLLEVHIFSA 624
                  4444155677*******9999644..33445556679********77555555..*************************99777799999985 PP

6B353.35e-17659753199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  ff + + +++l+ g l lp kf++++  k   s  +tl+ ++gr+W+v++ + ++   + ++ GWk F++an+L +gD+++F+l++ se+ l+v +fr
  DCAR_003837 659 FFRINVYPSSLSGGSLGLPQKFVKRFITK--DSCNVTLRISDGREWSVRCGVYNSC--TKFSVGWKIFAQANRLAAGDVCIFELINFSEKLLNVVIFR 752
                  677778889999999********999545..34579999999********555555..55899*********************97788879999998 PP

                  S CS
           B3  99 k 99 
                  +
  DCAR_003837 753 E 753
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.478169IPR003340B3 DNA binding domain
SMARTSM010190.27169IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-13869IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-13869IPR015300DNA-binding pseudobarrel domain
CDDcd100171.42E-9967No hitNo description
PfamPF023624.4E-8968IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.1E-21158262IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.37E-18161261IPR015300DNA-binding pseudobarrel domain
CDDcd100172.07E-16164260No hitNo description
SMARTSM010196.9E-11166262IPR003340B3 DNA binding domain
PROSITE profilePS5086312.774167262IPR003340B3 DNA binding domain
PfamPF023622.0E-15177261IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-19292379IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-19293379IPR015300DNA-binding pseudobarrel domain
CDDcd100171.58E-15297385No hitNo description
PROSITE profilePS5086310.306298377IPR003340B3 DNA binding domain
SMARTSM010192.5E-10298383IPR003340B3 DNA binding domain
PfamPF023624.7E-15299379IPR003340B3 DNA binding domain
PfamPF023629.3E-13383459IPR003340B3 DNA binding domain
SuperFamilySSF1019361.06E-17384462IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-18384462IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.6E-6384461IPR003340B3 DNA binding domain
CDDcd100173.42E-12384459No hitNo description
PROSITE profilePS5086312.576385461IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.6E-20521624IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.06E-18524626IPR015300DNA-binding pseudobarrel domain
CDDcd100171.77E-17527623No hitNo description
SMARTSM010198.0E-10529625IPR003340B3 DNA binding domain
PROSITE profilePS5086311.843530625IPR003340B3 DNA binding domain
PfamPF023621.5E-14532624IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-20653752IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-20653752IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.043659754IPR003340B3 DNA binding domain
SMARTSM010196.6E-16659754IPR003340B3 DNA binding domain
PfamPF023625.4E-16659753IPR003340B3 DNA binding domain
CDDcd100174.30E-14677752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MNLGGLSRIS LKVPNGLAWR VTLKTRNGDV WLKNGWTEFA RFYSVKFGHL LIFKYRGHSE  60
FKVRIFDSSS TEIDYPSFRS AKLDMGESSQ MRKRASEIHH SASSHLMRPH KKRVKNHAPN  120
DAGHSGVFMT QNLQQETKKS GNCASKEAEA RALALAEAFR TDNPFFVYVM RRTYVDGKGR  180
GLVIKKAFEE SYKKWKDNDQ VHLQVEGKKW LVHCDMKQDS CRLSSGWDKF VQDNSLTVGD  240
VCVFELVDER RRLLQVVIFR ATKGTKGQEN EILPRVKSEA KPARVVASVN AFASKYPCFK  300
AKVCPSCLYG ASLTVPRKFI KKYITEDCCH VTLENSDGET WLVKCSAYES GTKFGVGWKQ  360
FARANQLAVG DVCAFELINF SEKMIPRKFV RKHGNKLGSR ISLKAPNGLV WKVNLERDEN  420
EVWLQDGWPQ FAKFYSIQFG HLLFFKYRGH CDFKVRIFDP SCTEINYPSS KSAKLKSGES  480
SKKRKRAIET DHLMLKLQKE KRDCPQEIEE ARARALASAE AFKSDNPVFL RVMKISHVDG  540
KRRGLVLSKA FEETYKKWKD NDQVHLQVAG RIWPVNCIMK WNRCRLGSGW DRFAQDNSLS  600
VGDVCVFELI NTCTKLLEVH IFSAAEETNE NTRLPRVKRE AKEAKVPASV DAFTSRYPFF  660
RINVYPSSLS GGSLGLPQKF VKRFITKDSC NVTLRISDGR EWSVRCGVYN SCTKFSVGWK  720
IFAQANRLAA GDVCIFELIN FSEKLLNVVI FREVAECCHQ C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1414562628144B3 domain-containing transcription factor VRN
4i1k_B1e-1414562628144B3 domain-containing transcription factor VRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-21B3 family protein