PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Dof
Protein Properties Length: 343aa    MW: 37257.2 Da    PI: 7.9564
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003439genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.1e-392786362
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  +a +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGGalrn+P+Ggg+rknkk+s
  DCAR_003439 27 AEAPRCPRCDSPNTKFCYYNNYSLSQPRYFCKTCRRYWTKGGALRNIPIGGGCRKNKKMS 86
                 56779****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-323084IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7893084IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253184IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MMSQDNLNPN PPDDSSGNSQ KGACRPAEAP RCPRCDSPNT KFCYYNNYSL SQPRYFCKTC  60
RRYWTKGGAL RNIPIGGGCR KNKKMSSKSC SRFASDSMDS GGSSSYLDHL GGFKFSNIGL  120
SSGMNFQTLD TNLPRTFSPV QQYQQLSTNS SFGNFSRTLS SPCFSLENQT GSSSGSGFMG  180
LNFPLSSSGI KQVHGSAQLL QDHDLDIKNN DVVASSIESL SSINQDLHWK LQQQRLGMMM  240
FSEENSITDQ KEGLGNTSVI MPPKPQPILF ENLEISSRVK DHDVHQAVGG SGSGSGTSGT  300
EWLLDHNSNH SLGNAAQTNS SNTGINGMNQ AWGNFYQYTP LP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017218525.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A162B6Z00.0A0A162B6Z0_DAUCS; Uncharacterized protein
STRINGEOX918923e-76(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-47Dof family protein