PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 93aa    MW: 10257.8 Da    PI: 7.1821
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003241genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS64.32.5e-201079170
         GRAS  1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70
                 l++ L++ A++v++g+ e+a+  L+++s+l+spdgd+mqR+aa+fteALa r+++ +++l kal++++ +
  DCAR_003241 10 LIHILVTTANHVAAGSIENANISLEQISHLSSPDGDTMQRIAAHFTEALADRMLKRWPGLHKALNSTKIT 79
                 6899************************************************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098511.882192IPR005202Transcription factor GRAS
PfamPF035148.5E-181079IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MKLEERGLYL IHILVTTANH VAAGSIENAN ISLEQISHLS SPDGDTMQRI AAHFTEALAD  60
RMLKRWPGLH KALNSTKITL VSEERLGHYV LL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017256387.14e-49PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-36SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A166HZL12e-60A0A166HZL1_DAUCS; Uncharacterized protein
STRINGEOY176062e-42(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.14e-39scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]