PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003235
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 943aa    MW: 105264 Da    PI: 6.8287
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003235genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS440.11.6e-1345159371374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++ A++v++g+ e+a+  L+++s+l+spdgd+mqR+aa+fteALa r+++ +++l kal++++ +  ++see  ++klf+e++P+lk+s++++
  DCAR_003235 515 LIHLLVTTANHVAAGSIENANMGLEQISHLSSPDGDTMQRIAAHFTEALADRMLKRWPGLHKALNSTKIT--SVSEERLVQKLFFELCPFLKLSYVIT 610
                  689*************************************************************999998..5999999******************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaI ea+ege+ vHiiD++  +++QW++Llq +++Rpegpp+lRiTg+++    +ke l e+++rL++ A +l++pf+fn  ++++le+l++e+Lrv
  DCAR_003235 611 NQAIIEAMEGEKVVHIIDLNSVEPAQWINLLQLFSARPEGPPHLRITGIHE----QKEVLDEMAHRLNEEAGNLDIPFQFNS-IVTKLENLDIESLRV 703
                  ***************************************************....9**************************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrll......................................................desvsles..erdevLklvkslsPkv 238
                  k+gEa+aV++vlqlh+ll                                                      ++++sl+s  +   +L++++slsPk+
  DCAR_003235 704 KTGEAVAVSSVLQLHHLLafddemlrrnsplvnkgfssihmqaalqnnthtlgdflekdmmsgytpspdstsSSPLSLASapKMVMFLNALWSLSPKL 801
                  **********************************************************************9966666666656778************ PP

         GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                  +vv+eqe++hn+ s+++r+ eal++y++lfd+l ++++r   +r+k+E++l+g+ei+n+++ceg er+erhe+lekW  rle+aGF+ v ls+++++q
  DCAR_003235 802 MVVTEQESNHNGCSLMDRIYEALNFYASLFDCLPSTASRVPVDRQKLEKMLFGEEIKNIISCEGLERKERHEKLEKWIPRLEMAGFGRVGLSYHTMMQ 899
                  *********************************99999999********************************************************* PP

         GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  a++ll+ ++ +g++++ee+g+lv++W+++pL+svSaWr
  DCAR_003235 900 ARTLLQSYGYEGFKIKEEHGCLVMCWQNQPLYSVSAWR 937
                  *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF493631.06E-21202317IPR008963Purple acid phosphatase-like, N-terminal
Gene3DG3DSA:2.60.40.3801.3E-18217318IPR015914Purple acid phosphatase, N-terminal
PfamPF166563.0E-14221315IPR015914Purple acid phosphatase, N-terminal
PfamPF001491.4E-8332415IPR004843Calcineurin-like phosphoesterase domain, apaH type
SuperFamilySSF563006.12E-18343421IPR029052Metallo-dependent phosphatase-like
Gene3DG3DSA:3.60.21.101.2E-30346461IPR029052Metallo-dependent phosphatase-like
PROSITE profilePS5098556.503489917IPR005202Transcription factor GRAS
PfamPF035145.4E-132515937IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003993Molecular Functionacid phosphatase activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MEQRVSFKLF IIFLSNIFVL LCLFSTSSSQ SPPRVDNLTK SEFANHTAIS DFRTINRRSL  60
EECPDPNPYL QIAVSSRNSK LADDEFVTVT ITGVLLPSES DWVAMVSPAH SNVTSCPSNA  120
IEYLQTGDYS TLPLLCHYPV KAQYVSSDPG YLGCKKKECK KRDKGGACVV TTCSASLKFH  180
VINIRTDIEF VFFSGGFLTP CILKRSTPRP FANPKIPLYG HLSSIDSTGN SMRVTWVSGD  240
NSPQQVQYGN GKSQISTVTT FSQDDMCKSP AKDFGWHDPG YIHSAVMTGL EPSTTLSYRY  300
GSNSAGWSNY TKFKTPPAGG SDEVRFLAFG DMGKAPRDPS LEHYIQYTWM KKDMASVNRT  360
RTPWLIFMGH RPMYSTPGDG LILIPSVDAD FVQAVEPLLL SNKVDLALFG HVHNYERTCA  420
VYQGECKAMP KKDGNGVDTY DNSNYKAPVH AIIGMAGFKL DSFSSTFMAG MVLEDGSPSV  480
SSPLQFFSLM SLSPGIGSPY PWLREMKSEE RGLYLIHLLV TTANHVAAGS IENANMGLEQ  540
ISHLSSPDGD TMQRIAAHFT EALADRMLKR WPGLHKALNS TKITSVSEER LVQKLFFELC  600
PFLKLSYVIT NQAIIEAMEG EKVVHIIDLN SVEPAQWINL LQLFSARPEG PPHLRITGIH  660
EQKEVLDEMA HRLNEEAGNL DIPFQFNSIV TKLENLDIES LRVKTGEAVA VSSVLQLHHL  720
LAFDDEMLRR NSPLVNKGFS SIHMQAALQN NTHTLGDFLE KDMMSGYTPS PDSTSSSPLS  780
LASAPKMVMF LNALWSLSPK LMVVTEQESN HNGCSLMDRI YEALNFYASL FDCLPSTASR  840
VPVDRQKLEK MLFGEEIKNI ISCEGLERKE RHEKLEKWIP RLEMAGFGRV GLSYHTMMQA  900
RTLLQSYGYE GFKIKEEHGC LVMCWQNQPL YSVSAWRFRR YS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3853493722375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017256387.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A166HZH30.0A0A166HZH3_DAUCS; Purple acid phosphatase
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]