PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_003040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family CO-like
Protein Properties Length: 353aa    MW: 38662.9 Da    PI: 5.1267
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_003040genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.27.1e-08638436
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                 + C+ ++   ++lfC+ ++ +lC  C  ++H  
  DCAR_003040  6 KSCESCKTSAATLFCKADSAFLCVVCDGKIHAA 38
                 57******99*******************9954 PP

2zf-B_box26.11.8e-084893342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  ++C+ +e+ +++  C+ +   lC  C   +H+       H+++p+
  DCAR_003040 48 VWMCEVCENSPASVTCKADAAALCVACDRDIHSAnplarrHKRIPV 93
                 689*****************************66899999999886 PP

3CCT70.83.5e-24289333145
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                  Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  DCAR_003040 289 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSE 333
                  9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.082350IPR000315B-box-type zinc finger
SMARTSM003362.6E-13350IPR000315B-box-type zinc finger
PfamPF006431.6E-6645IPR000315B-box-type zinc finger
CDDcd000215.30E-8850No hitNo description
PROSITE profilePS5011910.7224693IPR000315B-box-type zinc finger
PfamPF006434.6E-74893IPR000315B-box-type zinc finger
CDDcd000217.12E-94993No hitNo description
SMARTSM003369.3E-115193IPR000315B-box-type zinc finger
PfamPF062032.3E-18289331IPR010402CCT domain
PROSITE profilePS5101716.896289331IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGVGSKSCES CKTSAATLFC KADSAFLCVV CDGKIHAANK LASRHPRVWM CEVCENSPAS  60
VTCKADAAAL CVACDRDIHS ANPLARRHKR IPVVPFYDAA AASRGGGGEG DDDDQDRYFT  120
DPEMEEEEEA EAASWLLPNP NNQPLSNNNN NNNEYLLNHN QELDCSFLDI DVMNNTGNAR  180
VVADEKPPMN LLDSGNYGGN ADGVVPVQSY QTQPAPALVD GFPAYNMDYC GSRPFMYNFN  240
SQSISQSVSS SSLDVGLVPD HNAMTDVSNN ITQHPNSEPL PNPVSGLDRE ARVMRYREKR  300
KNRKFEKTIR YASRKAYAET RPRIKGRFAK RSEIDDVEAL ISTATYGVVP SY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017230434.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A166HTN00.0A0A166HTN0_DAUCS; Uncharacterized protein
STRINGXP_009758697.11e-135(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.18e-81CONSTANS-like 4