PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_002189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 977aa    MW: 110982 Da    PI: 7.0938
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_002189genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK42.61.2e-13574617245
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWP 45 
                  e++is+e+l+k+F  p+ dAAk+ g   ++ Kr CR +GIkRW 
  DCAR_002189 574 EESISFENLRKHFGRPLDDAAKSFGGNRSTFKRVCRDHGIKRWK 617
                  789****************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.083563647IPR003035RWP-RK domain
PfamPF020423.6E-12577616IPR003035RWP-RK domain
SuperFamilySSF542771.57E-16664745No hitNo description
PROSITE profilePS5174521.19668750IPR000270PB1 domain
SMARTSM006661.4E-17668748IPR000270PB1 domain
PfamPF005641.5E-15669745IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.2E-18669745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 977 aa     Download sequence    Send to blast
MGLGNDHENQ SNTQLREKIF VYLERFYCSI IEKTQSSGNI LVQFWVADIV TRAKGRQYCE  60
LRTQSQLFYH DQSDDRRLLS YRNHVVARSF RVSAGQEEDE GDDENWQELL GITGSVFKNK  120
KAEVSPRISH YSTDEYPERD FALSCGIQAS LCLPLFATDD FSGHPNGVIE LVFTSEEDFH  180
HLKPYIYYYY SVHSTLRMPE VKSILRSNIS CISISPDILN EIDHVLAVVS ETFQVPLAQC  240
WLSRDHSVGE YTVINQKGSL DYNNLVPWSK FKEACLQSYL DMGDGLVGRT FMSHTAFFCS  300
EITKLSIRSY PLAHYLGNCG SVDCFTMCLH NYTTGDKDYV IEFFLPHEQM DSQCPESLLN  360
SLLETLRQHF KTFVLASGEK LGTEMSVKVI DSFMYHESES FKIVCPNLSF PRQKIQQPGR  420
GVSWLTPSAW KLQWDTDTNF LLSVPCLSPL GSPKRLDQNV QVIETSGSSN SFSEDVSKTE  480
IPTRMKINRN VLTEESPGEE SQPLTFQSKK TIPRQEGKEG TQLLDPLAQQ LVLDDALQSQ  540
KKGLALGMEN FNTDIHIVNK TRIEVTSDRE NNSEESISFE NLRKHFGRPL DDAAKSFGGN  600
RSTFKRVCRD HGIKRWKSGK RRMGKNISSK LEGELNDEES SKRNFSHSGM APVEDRTVVA  660
HKIQDTNKMT VKATYNGVTI KFELSNLSGI TELQDKVIER LQVERKCFSI KYQDDEGDWI  720
LIACDKDVQE CIEISRSLKK TTIRMAFPSS NSASCVLLTT SNACYEHEKL YGRYVLDSQI  780
YCIILHVIGL LLKKFIVNYF PTQLNVAFFN ITPLRARENG NRAIVGIFGI AASVLLSAVQ  840
LKYQARTDSP FQDHPKAMTI AIASLLIFCF GCYVEQYLSS TRRSSTSAAL LHHFVRLLGF  900
ISLAYLASVI FSTSTSSIPS LIVFLIFPCF FSARFVFHWI RYRNLHGNRG AYNAPNSYFN  960
YIDTLPVYHI RSPNPV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017259069.10.0PREDICTED: protein NLP7-like isoform X1
TrEMBLA0A162B3J60.0A0A162B3J6_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.11e-37NIN like protein 7