PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_002090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 1237aa    MW: 135827 Da    PI: 5.5948
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_002090genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS462.72.2e-141474681374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl+cA++v++g+le+a+  L ++s+laspdgd+mqR+a+yf+eALa r+++ +++lykal++++ s    se + ++k+f+ev+P+lk++++++
  DCAR_002090  47 LIHLLLTCATHVATGSLENANLSLDQISHLASPDGDTMQRIASYFAEALADRILKAWPGLYKALHSTKLS--LFSEDILVRKIFFEVFPFLKVAFIVT 142
                  689*************************************************************999998..69************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaI ea+ege++vHiiD+++ +++QW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+fn+ v+++l++l++e+Lrv
  DCAR_002090 143 NQAIIEAMEGEKMVHIIDLNAAYPMQWHALLQDLSARPEGPPHLRITGVHP----QKEVLDQMAHVLTEEAEKLDIPFQFNP-VVSKLDNLDIEQLRV 235
                  ***************************************************....9**************************.799************ PP

         GRAS 197 kpgEalaVnlvlqlhrll........................................................desvsleserdevLklvkslsPkv 238
                  k+gEala++++lqlh+ll                                                        ++s++   ++d +L+++++lsPkv
  DCAR_002090 236 KTGEALAISSILQLHSLLcpvdephkrsplttmksngvnllrasqikqstlgdllqkdmvngqspgadsassspQSSAPAV-QIDGFLNALWGLSPKV 332
                  ********************************************************************9887654444444.59************** PP

         GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                  +vv+eq+++hn++s++er++e+l++y+alfd+le++lpr s er k+E++l+g+e++n++aceg++r+erhe+lekW +rl+ aGF++vpls++ + q
  DCAR_002090 333 MVVAEQDSNHNGSSLMERLSESLYFYAALFDCLESTLPRSSMERLKLEKFLFGEEVKNIIACEGSSRKERHEKLEKWIQRLDFAGFGSVPLSYYGMLQ 430
                  ************************************************************************************************** PP

         GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  a++l++ ++ dgyr++ee+g++v++W+dr+L+svSaWr
  DCAR_002090 431 ARRLVQGYSCDGYRIKEENGCVVICWQDRALYSVSAWR 468
                  *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.61521448IPR005202Transcription factor GRAS
PfamPF035147.7E-13947468IPR005202Transcription factor GRAS
SuperFamilySSF525403.99E-45556871IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3004.3E-47556755IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF010781.2E-9558741IPR000523Magnesium chelatase ChlI domain
CDDcd000097.15E-7562754No hitNo description
TIGRFAMsTIGR020312.1E-2645651223IPR011776Magnesium chelatase, ATPase subunit D
SMARTSM003825.1E-5579759IPR003593AAA+ ATPase domain
Gene3DG3DSA:1.10.8.804.9E-8805869No hitNo description
SMARTSM003271.6E-2810311226IPR002035von Willebrand factor, type A
CDDcd014512.18E-7310321227No hitNo description
PROSITE profilePS5023414.81410331230IPR002035von Willebrand factor, type A
PfamPF135192.5E-1210341139IPR002035von Willebrand factor, type A
SuperFamilySSF533001.42E-2210341219IPR002035von Willebrand factor, type A
Gene3DG3DSA:3.40.50.4102.8E-1210341220IPR002035von Willebrand factor, type A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015995Biological Processchlorophyll biosynthetic process
GO:0009534Cellular Componentchloroplast thylakoid
GO:0009570Cellular Componentchloroplast stroma
GO:0005524Molecular FunctionATP binding
GO:0016851Molecular Functionmagnesium chelatase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1237 aa     Download sequence    Send to blast
MMFQDDGSSS VTSSPFQNSP MISLSPGLGS PYPLLKELKS EDRGLYLIHL LLTCATHVAT  60
GSLENANLSL DQISHLASPD GDTMQRIASY FAEALADRIL KAWPGLYKAL HSTKLSLFSE  120
DILVRKIFFE VFPFLKVAFI VTNQAIIEAM EGEKMVHIID LNAAYPMQWH ALLQDLSARP  180
EGPPHLRITG VHPQKEVLDQ MAHVLTEEAE KLDIPFQFNP VVSKLDNLDI EQLRVKTGEA  240
LAISSILQLH SLLCPVDEPH KRSPLTTMKS NGVNLLRASQ IKQSTLGDLL QKDMVNGQSP  300
GADSASSSPQ SSAPAVQIDG FLNALWGLSP KVMVVAEQDS NHNGSSLMER LSESLYFYAA  360
LFDCLESTLP RSSMERLKLE KFLFGEEVKN IIACEGSSRK ERHEKLEKWI QRLDFAGFGS  420
VPLSYYGMLQ ARRLVQGYSC DGYRIKEENG CVVICWQDRA LYSVSAWRCR RFSHFITLMA  480
LSPSPSSLQS SIFQQPIKVL HPTLLAPCSF KPSSKRRVLT IRGAAAATLE SSAAANNNGA  540
VGIVTPKDAS FGRQYFPLAA VVGQDAIKTA LLLGAIDRDI GGIAISGKRG TAKTVMARGL  600
HAILPPIEVV VGSISNADPA CPEEWEDGLA DRAYDSDKNV KTEIIRSPFI QIPLGVTEDR  660
LIGSVDVEES VKSGTTVFQP GLLAEAHRGV LYVDEINLLD EGISNLLLNV LTEGVNIVER  720
EGISFRHPCK PLLIATYNPE EGAVREHLLD RIAINLSADI PMSFEDRVAA VGIATEFQES  780
SNEVFNMMAE ETDYAKTQII LAREYLKDVI ISREQLKYLV MEALRGGCQG HRAELYAARV  840
AKCLTALEGR EKVIVEDLKK AVELVILPRS NISETPPEEQ NQQPPPPPPP PQSQEDSSEE  900
QNEEEDKDQE EENEDEKDEE NEQQQDQIPE EFIFDAEGGL VDEKLLFFAQ QAQRRKGKAG  960
RAKNVIFSED RGRYIKPMLP KGPVRRLAVD ATLRAAAPYQ KLRREMDTEK IRKVFVEKTD  1020
MRAKRMARKA GALVIFVVDA SGSMALNRMQ NAKGAALKLL AESYTSRDQV AIIPFRGDSA  1080
EVLLPPSRSI SMARKRLERL PCGGGSPLAH GLTTAVRVGL NAEKSGDVGR IMIVAITDGR  1140
ANISLKRSTD PEAAAASDAP KPSASDLKDE ILEVAGKIYK AGMSLLVIDT ENKFVSTGFA  1200
KEIARVAQGK YYYLPNASDA VISATTKNAL SDLKNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1g8p_A9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
2x31_G9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
2x31_H9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
2x31_I9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
2x31_J9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
2x31_K9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
2x31_L9e-5655386618323MAGNESIUM-CHELATASE 38 KDA SUBUNIT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in chlorophyll biosynthesis. Catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. The magnesium-chelatase is a complex of three subunits, CHLI, CHLD and CHLH. The reaction takes place in two steps, with an ATP-dependent activation followed by an ATP-dependent chelation step (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017257373.10.0PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic
SwissprotO241330.0CHLD_TOBAC; Magnesium-chelatase subunit ChlD, chloroplastic
TrEMBLA0A166GWL80.0A0A166GWL8_DAUCS; Mg-protoporphyrin IX chelatase
STRINGGorai.004G015600.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gräfe S,Saluz HP,Grimm B,Hänel F
    Mg-chelatase of tobacco: the role of the subunit CHL D in the chelation step of protoporphyrin IX.
    Proc. Natl. Acad. Sci. U.S.A., 1999. 96(5): p. 1941-6
    [PMID:10051574]
  2. Papenbrock J,Gräfe S,Kruse E,Hänel F,Grimm B
    Mg-chelatase of tobacco: identification of a Chl D cDNA sequence encoding a third subunit, analysis of the interaction of the three subunits with the yeast two-hybrid system, and reconstitution of the enzyme activity by co-expression of recombinant CHL D, CHL H and CHL I.
    Plant J., 1997. 12(5): p. 981-90
    [PMID:9418040]