PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001831
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 375aa    MW: 41895.7 Da    PI: 9.4421
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001831genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.72.1e-072432811755
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  A+rsR RK+++i+eLe+ v++L+a+ ++   ele l+++
  DCAR_001831 243 AQRSRVRKLQYIAELERNVQALQAKGSEVSAELEFLNQQ 281
                  89****************************999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0027232291IPR004827Basic-leucine zipper domain
CDDcd147035.67E-16234282No hitNo description
SuperFamilySSF579591.9E-5243285No hitNo description
Gene3DG3DSA:1.20.5.1702.1E-7243285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MANSKGPSSF RSMMHNGKHS LLPPKSPFPS IPPVYVDHFP CPATGAKRMT KPRDVSSNHQ  60
RTSSESVLIE DQPSWLDELL SEPETPVARG HRRSSSDSFA YVDAINAANM DHVAHDEYRS  120
RNMSSIHSWK SQDLNHHITS LHAEANSFGK HNNRAWNSPS NVMAHAAHPS GLLSAKDNFV  180
PRHSVPSGAS DEADWFPNKA IEKLDSAESG LNDAKALSER KDSSYAKTSA PETDTKRAKQ  240
QFAQRSRVRK LQYIAELERN VQALQAKGSE VSAELEFLNQ QNLILSMENK ALKQRLENLT  300
QEQLIKYLEH EVLEREIGRL RMLYQQQQQP PQQPPSFGHR RAKSRELDSQ FATLSLKPKV  360
SSSGTDTISG PLHS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017232533.10.0PREDICTED: uncharacterized protein At4g06598-like isoform X3
TrEMBLA0A166GNW20.0A0A166GNW2_DAUCS; Uncharacterized protein
STRINGcassava4.1_009724m1e-155(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27651733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-86bZIP family protein