PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001752
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 748aa    MW: 85782.9 Da    PI: 6.2197
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001752genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK52.21.2e-16566612248
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                  ek+i++e lsk+F  p+ dAA + gv+ ++ Kr CR yGIkRW  Rk
  DCAR_001752 566 EKTINFESLSKHFGRPLDDAAASFGVSRSTFKRLCRDYGIKRWQNRK 612
                  89*****************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.856551636IPR003035RWP-RK domain
PfamPF020424.5E-14568613IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2403.2E-18658737No hitNo description
SuperFamilySSF542777.57E-18658744No hitNo description
SMARTSM006662.0E-17659741IPR000270PB1 domain
PROSITE profilePS5174520.954659741IPR000270PB1 domain
PfamPF005642.1E-15660738IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MEDNTITEDS ECVAEIEQRV PRNSLIQVWK RSLTTSGVGF YELKIDPNYP SKITGCNEQG  60
DREQLLRYTT QSAGCRISLY DEKPKGVISR VFKKNRAEIS PNISYYSADE YPQRDFALSC  120
GIRTSFCFPW YNTFGCLGLP EGVVEFVSSL DQDLETITCY CRSLEGYKFY VSSSLLFCGR  180
MNSQAFAIPE IDHLLERVFQ TFKVPVAQYW IYSDLSETFR VVHQFSSREF ENLASWWEFK  240
DVCLHMPLKK YEGLVGTRYF SHESCFFRDI TELSIDDYPF KHYAQKCGSI ASFTIRLHSP  300
YPPSKAYVLE FLFPSQGNDS YHPQTLLNSL LVEMKEHLPN FMLTSGEQLV HVSSVKVINI  360
STLENPKSFD IGQPDSSLPR HEGLLYTHTM KLFKDGTEQS SNLTSYEEAA TGETSKRTPS  420
EVPEIVHLDE SEQESDILCT EHRSFSSQHK KLKNILEHNW NAAEMDLSAM EMTLEEASKL  480
KKHAMTADRV NEQVEESPMS NKHIGRAMTT ASQPTMKLLA QHQKEFIVPD DNSKKKFILL  540
EDDTTIHVEN KTSMEAHTSE SERKSEKTIN FESLSKHFGR PLDDAAASFG VSRSTFKRLC  600
RDYGIKRWQN RKRRMDGDVS SKLTTKLKNE EPSIRNFSYS GTTPVQDTIV ARTGQELNEM  660
TVKVTYNGIN IRFKLPGSSG MAELENNVIE RLHLERKSFS IKYQDDEEDW VLIACDRDVW  720
ECMQLARSLK KSTIKLLLDL PIHHHAP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017232117.10.0PREDICTED: protein NLP7-like isoform X1
TrEMBLA0A162AH760.0A0A162AH76_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-30NIN like protein 7