PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 203aa    MW: 22404.2 Da    PI: 4.5417
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001619genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like48.42e-15801112556
      G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  + AtPk+i+el++v++Lt+++vkSHLQkYRl+
  DCAR_001619  80 QLATPKQIRELIQVDDLTNDEVKSHLQKYRLH 111
                  569***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-680114IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-1380111IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-1380114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MIFNSQQLSL KTRPIFNAPN TITDLLGDVC NISDQIDKLN DIIQRLQDEI IKIDAFKTEL  60
PLTVLFVNDA IVALKEEIMQ LATPKQIREL IQVDDLTNDE VKSHLQKYRL HTRKVPSGTT  120
PTPANGPAAS ALGRLWSCKD QYSESAKQSM SQSGSPQGPL QLTETTGGTS TVKTDSMDDD  180
EDDKSQSYCC KTWIQTSINS DV*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017248592.12e-74PREDICTED: probable transcription factor KAN3
SwissprotQ9FX842e-18HHO6_ARATH; Transcription factor HHO6
TrEMBLA0A162B1Z01e-146A0A162B1Z0_DAUCS; Uncharacterized protein
STRINGXP_010255132.13e-37(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-17G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]