PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 180aa    MW: 20124.9 Da    PI: 5.5172
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001141genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.22.7e-16130173548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  +r+rr++kNRe+A rsR+RK+a++ eLe  v +Le+eN+ L ke
  DCAR_001141 130 QRQRRMIKNRESAARSRERKQAYQVELESMVMKLEEENELLLKE 173
                  89************************************988877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.2E-6126177IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.519128177IPR004827Basic-leucine zipper domain
PfamPF001708.0E-14129173IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-10130174No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-13131176No hitNo description
PROSITE patternPS000360133148IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASTDLKPLD SNATDLTLSI SGIFSSSSTS PPPRRKTVDE VWGEIVAQTA KKELKVEPSD  60
DGELMTLEDF LAKADAKVEE TEVVKVERLW SDAGVYGRAV GGGIVSERSG VEEGRKGKRR  120
VESLDKVVMQ RQRRMIKNRE SAARSRERKQ AYQVELESMV MKLEEENELL LKEKVHLYL*
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017246910.11e-120PREDICTED: G-box-binding factor 4-like
SwissprotP427773e-30GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A166G6X01e-124A0A166G6X0_DAUCS; Uncharacterized protein
STRINGXP_009803830.19e-35(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27712452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-20bZIP family protein