PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 557aa    MW: 61827.6 Da    PI: 4.5695
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001121genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS434.39.1e-1331875562374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lL+ cA  +s+g+ e+a++++ +l++++s +g+p +R+aay++eALaar+a s+++lykal+++e++   s ++l+a+++++ev+P+++f++++aN
  DCAR_001121 187 KQLLFYCAVTISNGNVENASTMIDELRQRVSIQGEPSERIAAYMVEALAARMATSGKGLYKALKCKEAP---SLDRLSAMQVLFEVCPCFRFGFMAAN 281
                  589*****************************************************************9...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   aI ea+e+e++vHi+Dfdi+qG Q+++Llq+La+  ++ p lR+Tgv++pes    + +l+ +g+rL+++A++l+vpfef++ v+ ++e++++  L+
  DCAR_001121 282 GAIIEALENERKVHIVDFDINQGSQYITLLQTLANYHGKLPLLRLTGVDDPESLqrATGSLKLIGQRLEQLAQALEVPFEFQA-VVANTEEVTPAILD 378
                  ***************************************************999888899***********************.7999********** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                   +p+Eal+Vn+++qlh+++desvs+ ++rd++L++vks++Pk+v+vveq++++n+++Fl rf+ea ++y a+fdsl+a+lpr+s++r++vE+++l+r+
  DCAR_001121 379 HHPDEALVVNFAFQLHHMPDESVSTVNQRDKLLRMVKSMNPKLVTVVEQDVNTNTAPFLPRFAEAYNFYYAIFDSLDATLPRDSQDRMNVEKQCLARD 476
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivnvvaceg+er+er e ++kWr+r+++aGF++ p++ +++ +++ l+++++++ ++v+ee ++l +gW+d+ L+++SaW+
  DCAR_001121 477 IVNVVACEGEERIERYEVAGKWRARMMMAGFEACPIGPDVNVSIRELIKRYSDR-FKVKEEINALHFGWQDKILIVASAWK 556
                  ****************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.166160537IPR005202Transcription factor GRAS
PfamPF035143.2E-130187556IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSLVGSSSSS YGNRKHYSLT GSKKKSGLSA SMDSSNKPKI LYGTGSDSTE SYDPSYILDS  60
PSSEVVQLVA AQQISDSPDA ANINSHSSLS KYQSDDLEGQ FTEAMDFDDS RMRLKLQELE  120
RELLDENDED DSILGPNESM EIESGWADAV PNALIHDSPK ESSSIDSNIS SISSSKEVSL  180
LPDDNPKQLL FYCAVTISNG NVENASTMID ELRQRVSIQG EPSERIAAYM VEALAARMAT  240
SGKGLYKALK CKEAPSLDRL SAMQVLFEVC PCFRFGFMAA NGAIIEALEN ERKVHIVDFD  300
INQGSQYITL LQTLANYHGK LPLLRLTGVD DPESLQRATG SLKLIGQRLE QLAQALEVPF  360
EFQAVVANTE EVTPAILDHH PDEALVVNFA FQLHHMPDES VSTVNQRDKL LRMVKSMNPK  420
LVTVVEQDVN TNTAPFLPRF AEAYNFYYAI FDSLDATLPR DSQDRMNVEK QCLARDIVNV  480
VACEGEERIE RYEVAGKWRA RMMMAGFEAC PIGPDVNVSI RELIKRYSDR FKVKEEINAL  540
HFGWQDKILI VASAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A4e-5819355525377Protein SCARECROW
5b3h_D4e-5819355525377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017230133.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_017230134.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A166G6D60.0A0A166G6D6_DAUCS; Uncharacterized protein
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]