PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family NAC
Protein Properties Length: 297aa    MW: 34218.5 Da    PI: 6.3165
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000935genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.18.6e-50101381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat++gyWkatgkd+ vl+  ++
  DCAR_000935  10 LPPGFRFYPSDEELVCHYLFKKIAKEEVLK-GTLVEIDLHTCEPWQLPEVAKLNSTEWYFFSFRDRKYATGFRTNRATTTGYWKATGKDRVVLDPkTN 106
                  79************************9655.78***************88888999*************************************98566 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  + vg++ktLvfyk+rap+g+kt W+mhe+rle
  DCAR_000935 107 AIVGMRKTLVFYKNRAPNGVKTGWIMHEFRLE 138
                  77***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-618156IPR003441NAC domain
PROSITE profilePS5100557.44210156IPR003441NAC domain
PfamPF023653.9E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGLRDIGAEL PPGFRFYPSD EELVCHYLFK KIAKEEVLKG TLVEIDLHTC EPWQLPEVAK  60
LNSTEWYFFS FRDRKYATGF RTNRATTTGY WKATGKDRVV LDPKTNAIVG MRKTLVFYKN  120
RAPNGVKTGW IMHEFRLENP NLPPKEDWVL CRVFHKAKTE NNNQLSPQDV FEVQEATAGD  180
TSPVSSNRIP PLGSYYHHQQ HYNHFTPQGP PSYQQPNTLL QFPSLTNPNF LQLSHHQPHT  240
DTSTTLARVN DIMTVNSKCE DQNDYKFLFH DINFEDGNMV DELDSDMHGI MFDDCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-461015917168NO APICAL MERISTEM PROTEIN
1ut4_B1e-461015917168NO APICAL MERISTEM PROTEIN
1ut7_A1e-461015917168NO APICAL MERISTEM PROTEIN
1ut7_B1e-461015917168NO APICAL MERISTEM PROTEIN
3swm_A2e-461015620168NAC domain-containing protein 19
3swm_B2e-461015620168NAC domain-containing protein 19
3swm_C2e-461015620168NAC domain-containing protein 19
3swm_D2e-461015620168NAC domain-containing protein 19
3swp_A2e-461015620168NAC domain-containing protein 19
3swp_B2e-461015620168NAC domain-containing protein 19
3swp_C2e-461015620168NAC domain-containing protein 19
3swp_D2e-461015620168NAC domain-containing protein 19
4dul_A1e-461015917168NAC domain-containing protein 19
4dul_B1e-461015917168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}.
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017238569.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like isoform X2
SwissprotO040171e-60NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
SwissprotQ84TE65e-61NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A166FZZ10.0A0A166FZZ1_DAUCS; Uncharacterized protein
STRINGXP_009607926.11e-116(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.15e-93NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  5. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  6. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  7. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  8. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  9. Vialette-Guiraud AC, et al.
    A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids.
    Front Plant Sci, 2015. 6: p. 1239
    [PMID:26793217]
  10. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  11. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  12. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]
  13. Biot E, et al.
    Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis.
    Development, 2016. 143(18): p. 3417-28
    [PMID:27387872]
  14. Zheng M, et al.
    Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development.
    Plant Physiol., 2016. 172(2): p. 1117-1130
    [PMID:27535792]
  15. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  16. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  17. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]
  18. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]
  19. Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
    Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.
    New Phytol., 2018. 217(3): p. 1307-1321
    [PMID:29139551]
  20. Gonçalves B, et al.
    GDP-L-fucose is required for boundary definition in plants.
    J. Exp. Bot., 2017. 68(21-22): p. 5801-5811
    [PMID:29186469]
  21. Sha S, et al.
    To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes.
    Ann. Bot., 2018. 121(2): p. 255-266
    [PMID:29267935]
  22. Maugarny-Calès A, et al.
    Dissecting the pathways coordinating patterning and growth by plant boundary domains.
    PLoS Genet., 2019. 15(1): p. e1007913
    [PMID:30677017]