PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TCP
Protein Properties Length: 208aa    MW: 21979.8 Da    PI: 4.8938
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000906genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP73.37.5e-2325107688
          TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                  ++ ++  Tkv+gR+R + ++a caa++ +L++ LGf++ ++t+eWLl+  ++++ + +gt  +sa+++ a s+  ++ +++++
  DCAR_000906  25 KPMKDKQTKVEGRGRKIKMPAACAAQISQLTKDLGFKSSGETVEWLLEREEESMVQGPGTAIPSANAAGATSEALEVPEKKKA 107
                  6789********************************************************99999888666666666644333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.5E-162791IPR005333Transcription factor, TCP
PROSITE profilePS5136914.0012781IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MSTVKDYDSD SQANSGSQQT SSGPKPMKDK QTKVEGRGRK IKMPAACAAQ ISQLTKDLGF  60
KSSGETVEWL LEREEESMVQ GPGTAIPSAN AAGATSEALE VPEKKKAEAV GQDGVPKTSG  120
FAPGNPNPVF VPGKGFFMVP EDGGEPQQVW PVPLALTRGI GMRMPGPYAP GWSSVSSDGM  180
TFECPGRNGE FLEFWGSLIL FYKVSCV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017245402.11e-150PREDICTED: transcription factor TCP21-like
TrEMBLA0A166FZ891e-148A0A166FZ89_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-14TCP family protein