PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 356aa    MW: 40057.8 Da    PI: 7.4944
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000813genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK42.51.3e-13260306450
       RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                  +++++d+  yF+l   +AAk Lg+++T LK i R+ GI+ WP R ++
  DCAR_000813 260 TLTIQDVLPYFHLRQSEAAKLLGLGTTKLKEIVRNAGIPKWPAREVN 306
                  78999***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.663242329IPR003035RWP-RK domain
PfamPF020424.4E-14260306IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MKGRKKRTPK KRAPSHNDPH GETGTTDNVV RPNEFVDVSV NDFEQPGGDD IMFNAGGDAD  60
DPSRWEYQSE YVHNPFGAGP SGVNNQRGSS GVNNQRSEQN TVISDPGNSA FENPTQFFEW  120
PDPPRQYDCT YCQVLRYIVH IKGQEQSTKL EIHGRIGMVC HGILEISSGD TTAPNREYRT  180
FDFCQKSLSD VKKFLIEYYE DRANTSYATV DDPLLTFYDT LCARSEYDWV FNNDNEAEAQ  240
GGGVRPKKRT VVEQRAYCET LTIQDVLPYF HLRQSEAAKL LGLGTTKLKE IVRNAGIPKW  300
PAREVNAKDR AIKKIVKKMN PSNPRKKAMA EKEIQELQKA IADIYAPLQK KNAAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017244597.10.0PREDICTED: uncharacterized protein LOC108216354
TrEMBLA0A166FT650.0A0A166FT65_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027