PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 207aa    MW: 23255.7 Da    PI: 8.6835
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000800genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.81.1e-35111101100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lapyfp +++++f nvhklFG +n+++ +k++++++re++++s++ eAe r+ dPv G++g++++l  + eq+k+el+++ 
  DCAR_000800  11 ACAACKHQRRKCAPDCPLAPYFPPHRQAEFLNVHKLFGIRNIINAVKTVDPNQREIVVRSMIEEAELRVMDPVGGSCGMVKSLYDKCEQVKVELDMVF 108
                  7*********************************************************************************************9887 PP

       DUF260  99 ee 100
                  ++
  DCAR_000800 109 QQ 110
                  66 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.60310111IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3411107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MTGPGTNVSQ ACAACKHQRR KCAPDCPLAP YFPPHRQAEF LNVHKLFGIR NIINAVKTVD  60
PNQREIVVRS MIEEAELRVM DPVGGSCGMV KSLYDKCEQV KVELDMVFQQ LAICRAKSKN  120
VEVRRGVRSF YDNLMPRHPG NGALRPPRNN IEISKKTSVK NENDGVEALQ IGVNEEKGAK  180
KMRNIDINKE SREIEENDLD KEDVKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2421114111LOB family transfactor Ramosa2.1
5ly0_B2e-2421114111LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017223390.11e-151PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A166FSU51e-150A0A166FSU5_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_25.411e-39(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1783424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-33LOB domain-containing protein 22