PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 329aa    MW: 36278.8 Da    PI: 5.0612
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000690genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.42.4e-16154208458
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  ++r +r+ +NRe+ArrsR+RK+a +  Le+ v++L +eN++L k++ + +++ + 
  DCAR_000690 154 VRRIKRMVSNRESARRSRRRKQAHLSDLEQQVDQLRGENSTLFKNMTSANQQFKD 208
                  6899***************************************988887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-15151215IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576153216IPR004827Basic-leucine zipper domain
PfamPF001704.1E-14154205IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.6E-12155207No hitNo description
SuperFamilySSF579593.8E-12155205No hitNo description
PROSITE patternPS000360158173IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MERSNKMNKI PSEIDLEDIF NQHINDQDVK AHRPITPPGF ADDAVGYRDD HPSQLPTFPF  60
PDQEIMNGFS NCAEVTEASL WCQNFSAPKH SSISVTMDSQ SSICAGSPTS AANNLPKGCE  120
NQAMGVTSGS YDQSDDDDID TEAGPCEQSD QAGVRRIKRM VSNRESARRS RRRKQAHLSD  180
LEQQVDQLRG ENSTLFKNMT SANQQFKDAT NNNRVLKSDV EALRAKVKLA EDMVTRGSLT  240
SSITNIIQNH LYNTPQSFGT QNIHRMGNVS PTITVQRDDP SYPGLTGSGQ TDNVDHFNGN  300
IDNNIINDSV SCTSEIWPWG SHVPTMSK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167174RRSRRRKQ
2169174SRRRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017222394.10.0PREDICTED: basic leucine zipper 9-like
SwissprotQ9FUD32e-62BZIP9_ARATH; Basic leucine zipper 9
TrEMBLA0A166FPC00.0A0A166FPC0_DAUCS; Uncharacterized protein
STRINGVIT_04s0008g02750.t011e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81392229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.17e-50basic leucine zipper 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ortiz-EspĂ­n A, et al.
    Mitochondrial AtTrxo1 is transcriptionally regulated by AtbZIP9 and AtAZF2 and affects seed germination under saline conditions.
    J. Exp. Bot., 2017. 68(5): p. 1025-1038
    [PMID:28184497]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]