PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 646aa    MW: 72443 Da    PI: 6.2555
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000591genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS405.55.2e-1242616291373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++l+++c+ea++ +d ++++ ++a+l elasp+g+++ Rl ayf eALa r+ar+++ ++++ +p+  + +  +++ +al++++++sPi++f h+ta
  DCAR_000591 261 LISLIVACVEAIAMKDIRRVNYFIAKLGELASPKGSSTSRLSAYFIEALAIRVARMWPLIFHITTPRVLN-QLDDDNGTALRFLNQISPIPQFIHFTA 357
                  57899*********************************************************99999998.678889999****************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  N+ +l+ +eg++++HiiDfdi+qGlQWp+++q+La+R++ p ++Ri g+g+    sk+el etgerLa fAe+l +pf+f++ v++rled++l++L+v
  DCAR_000591 358 NEILLRGFEGKDMIHIIDFDIKQGLQWPSFFQSLACRKNRPSHVRISGIGE----SKQELMETGERLAGFAEALSLPFKFHP-VVDRLEDVRLWMLHV 450
                  ***************************************************....***************************.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  k+gE++aVn++lqlh++ d+  s     +++L l++s++Pk v+++eqeadhn +++  r++++l+yysa+fds++++lp +s  rik+E++ +grei
  DCAR_000591 451 KEGECVAVNCILQLHKMQDDG-SEGV-LRNFLGLIRSTNPKTVILAEQEADHNYNTLNSRLCNSLRYYSAIFDSIDTSLPVDSLVRIKIEEM-FGREI 545
                  *****************8444.4333.699**************************************************************.***** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.....sgslvlgWkdrpLvsvSaW 373
                  +n++aceg+er erhet+++W++ +++ GF+ + +++++  q ++ll++++sd ++ve++     s++l+l W d+pL++vS W
  DCAR_000591 546 RNIIACEGRERLERHETFGTWSKLMRQGGFQCIGITDRELIQSRMLLKMYSSDKFQVEKQeldhdSEALTLSWLDQPLYTVSGW 629
                  ***************************************************999****555555599999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.471235605IPR005202Transcription factor GRAS
PfamPF035141.8E-121261629IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MSTQRFDFPC SFSQKESSGS QPVRPPVGVS VERPIEARNY SLKKSISLPP LATTGQDTFL  60
EGRRGEKKDV FWDRRGKNLK RFADEVSFHD DESCISRAKR KRGGWKSDDF SEGGGNVSLG  120
QLGSGNFLFR PDLEVPTSLS LIAGLDQSQV SIPVSCLGED SIDLLKPREL SSRNKSWVDS  180
VVTKFTKLTD QNVETIQGGT VNEEVSILRS PSEKDILTIR PTENTTVHER GNSSGPHNAN  240
TSADYSTGKN DEHGEHEGFE LISLIVACVE AIAMKDIRRV NYFIAKLGEL ASPKGSSTSR  300
LSAYFIEALA IRVARMWPLI FHITTPRVLN QLDDDNGTAL RFLNQISPIP QFIHFTANEI  360
LLRGFEGKDM IHIIDFDIKQ GLQWPSFFQS LACRKNRPSH VRISGIGESK QELMETGERL  420
AGFAEALSLP FKFHPVVDRL EDVRLWMLHV KEGECVAVNC ILQLHKMQDD GSEGVLRNFL  480
GLIRSTNPKT VILAEQEADH NYNTLNSRLC NSLRYYSAIF DSIDTSLPVD SLVRIKIEEM  540
FGREIRNIIA CEGRERLERH ETFGTWSKLM RQGGFQCIGI TDRELIQSRM LLKMYSSDKF  600
QVEKQELDHD SEALTLSWLD QPLYTVSGWS PIDAAGSSSS YLQPG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6624963111380Protein SCARECROW
5b3h_A3e-6624963110379Protein SCARECROW
5b3h_D3e-6624963110379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017241887.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A166FLQ80.0A0A166FLQ8_DAUCS; Uncharacterized protein
STRINGEOY246320.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55682434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein