PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 601aa    MW: 66885 Da    PI: 5.1032
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000583genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31380434155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k r+rWt+e+He Fveav++LGGse+AtPk +l+ mkv+gLt++hvkSHLQkYR+
  DCAR_000583 380 KSRIRWTSEMHETFVEAVNKLGGSERATPKGVLKQMKVEGLTIYHVKSHLQKYRT 434
                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.127377437IPR017930Myb domain
SuperFamilySSF466894.84E-17378434IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-29378435IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-24380435IPR006447Myb domain, plants
PfamPF002497.5E-7384433IPR001005SANT/Myb domain
PfamPF143796.2E-21466511IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDAQPFLSFH RSGGRQSSNH ESIGVPSSCL PSLATVQEEK YPKLLNNQLV SVERELMSSP  60
SDLVPLSYNN GTVGHIFSGF SKESHFSIAS PHEKHSETFI SQTANAETSL LVQDTSAGIS  120
ENLQFCNASP HEKYSENGSF FSQTSVIVHN SCHQVPGVQS TSSTCYTKEN DSWCSDMLPE  180
FIDYPMTAEG NNYTEGGKVS SPVGLSEDCS MSSDLLDQLL NNNDALTSNW DHFENNCFTN  240
SELQFPYHVP AISIDDTVQM HQVHQQPLVH QHSQPQVYEN FPSASKEICT TQSTSDTVQQ  300
LQVQQQPLVL HKSQIHEQLA HASEEICTTP SMGCTLQLAQ VQQQLQAFQQ SQVQRQIPLA  360
SSKISMSGNQ LSSTSSTSNK SRIRWTSEMH ETFVEAVNKL GGSERATPKG VLKQMKVEGL  420
TIYHVKSHLQ KYRTTRYKPE SLEGSSDKNQ NLLGVMSSHD LKKDSEITET LRMQMELQKK  480
LHEQLEIQKN LQLRLEEQGR CLKMMFEKQQ ESGTDNPSAQ STVGIGNNHA QDGPKTTHMQ  540
HQVIRLSPDD VDEELEVIEG GSEKFKDART EPETETSKDP WADVTGGCDV QPENHVILID  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-28380438260Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017244069.10.0PREDICTED: uncharacterized protein LOC108215938
TrEMBLA0A166FLG70.0A0A166FLG7_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-55phosphate starvation response 1