PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g048296m
Common NameCISIN_1g048296mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 167aa    MW: 19594.4 Da    PI: 5.4964
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g048296mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.54.7e-251765149
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       krien+s r+v fskRr+g++KKA+EL+ LCd+e+a+i+fs++g+ly +
  orange1.1g048296m 17 KRIENNSSRKVAFSKRRKGMFKKASELCRLCDTEIAIIVFSPKGRLYSF 65
                       79*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-30968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.282969IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-251074IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-221131IPR002100Transcription factor, MADS-box
PfamPF003193.3E-241865IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-223146IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-224667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MPKKKPKGTG RKKIEIKRIE NNSSRKVAFS KRRKGMFKKA SELCRLCDTE IAIIVFSPKG  60
RLYSFGDHVI DKFIEDEIVS DIHSSSSSKE AIKENDCVTE LTGEEKSEEE DMHKEQTELE  120
FWWEQSIEDL NMEELEKYKS CLEELRSNVA MKVEEMVMRR TCEKDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-141092285Myocyte-specific enhancer factor 2B
1tqe_Q2e-141092285Myocyte-specific enhancer factor 2B
1tqe_R2e-141092285Myocyte-specific enhancer factor 2B
1tqe_S2e-141092285Myocyte-specific enhancer factor 2B
6c9l_A2e-141092285Myocyte-specific enhancer factor 2B
6c9l_B2e-141092285Myocyte-specific enhancer factor 2B
6c9l_C2e-141092285Myocyte-specific enhancer factor 2B
6c9l_D2e-141092285Myocyte-specific enhancer factor 2B
6c9l_E2e-141092285Myocyte-specific enhancer factor 2B
6c9l_F2e-141092285Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468188.11e-112agamous-like MADS-box protein AGL28
TrEMBLA0A067GSJ01e-117A0A067GSJ0_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006468188.11e-111(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-21AGAMOUS-like 62