PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g048263m
Common NameCISIN_1g048263mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 208aa    MW: 23091.2 Da    PI: 9.749
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g048263mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.4e-1494139247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++WT+ E+  ++++ k+lG+g+Wk I++ + ++Rt+ q+ s+ qky
  orange1.1g048263m  94 KPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKY 139
                        58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565217IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:1.10.10.601.5E-1086141IPR009057Homeodomain-like
PROSITE profilePS5129419.14888144IPR017930Myb domain
SuperFamilySSF466892.62E-1790144IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-1891143IPR006447Myb domain, plants
SMARTSM007173.1E-1092142IPR001005SANT/Myb domain
PfamPF002493.1E-1194139IPR001005SANT/Myb domain
CDDcd001671.96E-995140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MRKCSHCGHN GHNSRTCHAK GCFKLFGVNI LDQIQDLPSM KKSVKKSYSV GNLQSLGGEF  60
NGHVDEGREF DGDVDEGYLS DGPIHTKHER KRGKPWTEAE HRVFLEGLKL LGKGDWKGIS  120
KNFVTTRTPT QVASHAQKYF LRQASSDKKN RRTSLFDMPL KESGSTSSQA MNGFPNLCSD  180
LVVPVPATTG LAYYHHGIPY MVRINLI*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024043898.11e-141probable transcription factor At5g61620
SwissprotQ9FKF95e-53M5162_ARATH; Probable transcription factor At5g61620
TrEMBLA0A067EQ381e-154A0A067EQ38_CITSI; Uncharacterized protein
STRINGXP_006490065.11e-123(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.15e-41MYB_related family protein
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]