PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g047530m
Common NameCISIN_1g047530mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 72aa    MW: 7795.18 Da    PI: 10.0758
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g047530mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.31.7e-212672147
             DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
                       +CaaCk+lrr+C+++Cvlapyfp ++p+kf ++h++FGasn++k+l+
  orange1.1g047530m 26 PCAACKILRRRCVEKCVLAPYFPPTEPQKFVIAHRVFGASNIIKFLQ 72
                       7*******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.372572IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-202672IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
INASSSQSSP SFAAPQSPPP PVVLSPCAAC KILRRRCVEK CVLAPYFPPT EPQKFVIAHR  60
VFGASNIIKF LQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436214.13e-35hypothetical protein CICLE_v10033956mg, partial
RefseqXP_006485928.19e-35PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR09e-30LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK081e-29LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A067E0312e-44A0A067E031_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0008s04350.14e-30(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2065446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.13e-24LOB domain-containing protein 11