PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g047042m
Common NameCISIN_1g047042mg, LOC102624682
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 284aa    MW: 30464.3 Da    PI: 10.3667
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g047042mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-14122166347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ +++ + ++lG+g+W+ I+r++  +Rt+ q+ s+ qky
  orange1.1g047042m 122 AWTEEEHRKFLMGLEKLGKGDWRGISRKFVSTRTPTQVASHAQKY 166
                        7*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.776115171IPR017930Myb domain
SuperFamilySSF466891.64E-17116171IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-17118169IPR006447Myb domain, plants
SMARTSM007172.1E-11119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-11120165IPR009057Homeodomain-like
PfamPF002494.0E-12122166IPR001005SANT/Myb domain
CDDcd001674.70E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTS HKAVGGGGGG GSSLRLFGVQ LIDVSSSSPS SSSSSSIAMS  60
LKKSFSMDCL SSAAVPSSSS SNSSSLVSID EDKTAVGYLS DGLIMIPPTS NHQHQERKKG  120
VAWTEEEHRK FLMGLEKLGK GDWRGISRKF VSTRTPTQVA SHAQKYFLRL ASDLNKKKRR  180
SSLFDMIGIR SSMAAVHHRQ VNSSSKQEEQ PIRDESAARL HGLIDSQQQI KPSSNASSSK  240
PSLMPPNNSI LSPSDDDLEL KLATPNSVEE NKSSPKPLLI RVT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175179KKKRR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451435.10.0transcription factor MYBS3
RefseqXP_006475419.10.0transcription factor MYBS3
SwissprotQ7XC579e-47MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A067EVU60.0A0A067EVU6_CITSI; Uncharacterized protein
TrEMBLA0A2H5PDN80.0A0A2H5PDN8_CITUN; Uncharacterized protein
TrEMBLV4UKC60.0V4UKC6_9ROSI; Uncharacterized protein
STRINGXP_006475419.10.0(Citrus sinensis)
STRINGXP_006451435.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54962747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.18e-51MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]