PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g046286m
Common NameCISIN_1g046286mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 189aa    MW: 21585.5 Da    PI: 9.5855
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g046286mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.3e-32109167159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  orange1.1g046286m 109 LDDGYRWRKYGQKAVKNSLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 167
                        59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-3395167IPR003657WRKY domain
SuperFamilySSF1182901.31E-28102168IPR003657WRKY domain
PROSITE profilePS5081128.828104169IPR003657WRKY domain
SMARTSM007744.1E-38109168IPR003657WRKY domain
PfamPF031064.6E-26110167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MEGREPHPVS SPMSPQPNYL FTPSIPSSSM QPATLEPQVL PEIDWVSLLS AQSTDHNMME  60
STSHLNPENG GGRDQQDQGC KENKRKGSRM KKATRPRFAF QTRSADDILD DGYRWRKYGQ  120
KAVKNSLYPR SYYRCTHHTC NVKKQVQRLS KDTSIVVTTY EGIHNHPCEK LMETLTPLLK  180
QMQFLARF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2599166774Probable WRKY transcription factor 4
2lex_A9e-2599166774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00317DAPTransfer from AT2G46130Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444939.11e-140probable WRKY transcription factor 43
RefseqXP_006491470.11e-140probable WRKY transcription factor 43
SwissprotQ8GY114e-57WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBLA0A067HEP81e-140A0A067HEP8_CITSI; Uncharacterized protein
TrEMBLA0A2H5PH341e-140A0A2H5PH34_CITUN; Uncharacterized protein
STRINGXP_006491470.11e-139(Citrus sinensis)
STRINGXP_006444939.11e-139(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.12e-59WRKY DNA-binding protein 43
Publications ? help Back to Top
  1. Geilen K,Heilmann M,Hillmer S,Böhmer M
    WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions.
    Sci Rep, 2017. 7(1): p. 14235
    [PMID:29079824]