PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g045249m
Common NameCISIN_1g045249mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 212aa    MW: 24106.3 Da    PI: 5.2083
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g045249mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.93.7e-20953246
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                       + e+k   qvtfskRr g++ KA EL+vLC+aev +i+fs++gk+
  orange1.1g045249m  9 KLEDKNSLQVTFSKRRSGLFSKAMELCVLCGAEVGIIVFSPNGKI 53
                       56899999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002651.55E-35177No hitNo description
PROSITE profilePS5006624.656160IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-29159IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-26176IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-19222IPR002100Transcription factor, MADS-box
PfamPF003194.8E-221054IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-192237IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-193758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
GRQKIQIKKL EDKNSLQVTF SKRRSGLFSK AMELCVLCGA EVGIIVFSPN GKIFLAGHPD  60
FDKILNRYLD QNHSSLDEVN TIPCVQQHNK EYEDAMQELE KEKKRGKMIE EEKKKNKSNG  120
RFWWQEGNII DDMGIEELEE YLKAMKKLKG KVEMRVNEIM MNGYLAPNMN LGNDHPDAFG  180
NINVNVNEDI SVSGGIDGGV DFDFGFDEHF N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A8e-17182283MEF2 CHIMERA
6bz1_B8e-17182283MEF2 CHIMERA
6bz1_C8e-17182283MEF2 CHIMERA
6bz1_D8e-17182283MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024957821.11e-153agamous-like MADS-box protein AGL23
TrEMBLA0A067E2Q21e-153A0A067E2Q2_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006487056.11e-153(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15814714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.19e-35AGAMOUS-like 62