PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g044792m
Common NameCISIN_1g044792mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 220aa    MW: 24919.3 Da    PI: 5.2819
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g044792mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.53e-221765149
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       kr+e ks rqvtfskR++g++ KA+EL+vLC+aeva++i+s++ + +++
  orange1.1g044792m 17 KRVERKSARQVTFSKRKKGLFNKASELCVLCGAEVAIVIMSPHKRAFTF 65
                       7899**************************************9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.521969IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-26968IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-171131IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-2612100IPR002100Transcription factor, MADS-box
PfamPF003191.0E-221865IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MEASKQKNKG LQKIEIKRVE RKSARQVTFS KRKKGLFNKA SELCVLCGAE VAIVIMSPHK  60
RAFTFGHPNP DDVLDRFLTG AGAESSLAAT TVEDEKLERL KQEYVELLNR LKEEEKKRDE  120
IAKKRGNDRA NGVFWWDQYS IDDMERDELE LYLKSLEKLK TSVKSKVDEL AAASVASNNF  180
VNQFNIDNNI PIDFGSEFDD LCCLLEGTNE DGILRNLDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466132.11e-156agamous-like MADS-box protein AGL62
TrEMBLA0A067EF431e-158A0A067EF43_CITSI; Uncharacterized protein
STRINGXP_006466132.11e-155(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3327422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-27AGAMOUS-like 62