PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g044532m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 148aa    MW: 16795.2 Da    PI: 10.6406
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g044532mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.43.9e-181561147
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                       krien+  r +tfskRr gi KKA+EL +L++ e+a+++fs++gk +
  orange1.1g044532m 15 KRIENEDGRLITFSKRRSGIYKKASELVTLTGSEIAILVFSQSGKPF 61
                       79******************************************955 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.137767IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-27766IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-22884IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-18929IPR002100Transcription factor, MADS-box
PfamPF003193.8E-211663IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-182944IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-184465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MAAKKTKGRQ KIQMKRIENE DGRLITFSKR RSGIYKKASE LVTLTGSEIA ILVFSQSGKP  60
FSFGHPSIEA PVNDNTHPLV EAHRQMRRGK ETQPRWWETP VNELNHQELL QMDATIDNLH  120
KTFLARLNEK TAAASSSMAP PMYFHHK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hbx_A2e-14376679SERUM RESPONSE FACTOR
1hbx_B2e-14376679SERUM RESPONSE FACTOR
1hbx_D2e-14376679SERUM RESPONSE FACTOR
1hbx_E2e-14376679SERUM RESPONSE FACTOR
1srs_A2e-14376679PROTEIN (SERUM RESPONSE FACTOR (SRF))
1srs_B2e-14376679PROTEIN (SERUM RESPONSE FACTOR (SRF))
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269|PubMed:18713950}.
UniprotTISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492961.14e-95agamous-like MADS-box protein AGL62
SwissprotQ4PSU41e-27AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLV4RKB46e-99V4RKB4_9ROSI; Uncharacterized protein
STRINGXP_006421333.11e-99(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.17e-30AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]