PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g043963m
Common NameCISIN_1g043963mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 316aa    MW: 36288.7 Da    PI: 9.6797
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g043963mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.73e-131051243
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        i+ +  r +t+ kR+ g+ KKA+E  +LC++  ++ii++++
  orange1.1g043963m 10 LIDKEKARMITYQKRKRGLKKKAQEFATLCGVPTCMIIYGPR 51
                       5888999*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554555.76E-16151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.1151IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-11160IPR002100Transcription factor, MADS-box
CDDcd002663.17E-17281No hitNo description
PRINTSPR004042.1E-7323IPR002100Transcription factor, MADS-box
PfamPF003197.3E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRGKLTLKL IDKEKARMIT YQKRKRGLKK KAQEFATLCG VPTCMIIYGP RLNSHPGSVD  60
VEVWPKDHKE FMQVVNLYRD KAFTSVHGVK SQNLYDFFAD RNRKVYEKIV KIRKANFESK  120
FSSDLDEDFN NFSMHQLKGM LVVLDNNIDV ATRKLALIKG HHQNFGCYND NNNANNSAQV  180
LFQQPQPLAS HHVNMQLASY HHHEPIQMVS FDFNPVDNPT MMMMLMNGGD QIQLGCNTTA  240
LYNHHHPMQH AVYCDPVGAM IENRVMMNNP RAAMRFVGST MQQFQPFIEQ FPALPSPQFN  300
GFYGDNGFLR KREKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464863.10.0agamous-like MADS-box protein AGL82
TrEMBLA0A067EE550.0A0A067EE55_CITSI; Uncharacterized protein
STRINGXP_006464863.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16227914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-24AGAMOUS-like 82