PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g042591m
Common NameCISIN_1g042591mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 259aa    MW: 29448.7 Da    PI: 4.549
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g042591mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.14e-4081081101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rr+C++dC+lapyfpa+qp+ f+n+hklFG+sn+l+++k l+ e+r +am+s++yeA++r r Pv+G++gv+ +lq q+ q++a
  orange1.1g042591m   8 ACAACKYQRRRCSSDCPLAPYFPADQPRLFQNAHKLFGRSNILSIIKPLDAERRAEAMRSIIYEANIRDRYPVHGCLGVVCQLQYQIWQVEA 99 
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        el +++++l
  orange1.1g042591m 100 ELRAAQAQL 108
                        ***999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6337108IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-388105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MTLKASQACA ACKYQRRRCS SDCPLAPYFP ADQPRLFQNA HKLFGRSNIL SIIKPLDAER  60
RAEAMRSIIY EANIRDRYPV HGCLGVVCQL QYQIWQVEAE LRAAQAQLDM YRQMYYQQQL  120
STVAADDVPS QLELGMALPY IDALSLLHNN NTNDDDDAVA SYSYNSYSSL YMDARDVWVE  180
DTHAANNNNG SRRDCDEMHP FFDTVDDRQS YVDSKEAYES SSEESLKDTT QSIEHVGENE  240
LKTAAACFTL TSFFFFLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2621115114LOB family transfactor Ramosa2.1
5ly0_B1e-2621115114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423139.11e-160LOB domain-containing protein 27
RefseqXP_006479366.11e-160LOB domain-containing protein 27-like
SwissprotQ9STS62e-51LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A067EMK80.0A0A067EMK8_CITSI; Uncharacterized protein
STRINGXP_006479366.11e-160(Citrus sinensis)
STRINGXP_006423139.11e-160(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-49LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]