PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g042438m
Common NameCISIN_1g042438mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 89aa    MW: 10218.8 Da    PI: 10.7747
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g042438mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.52.4e-30959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krienk+nrqvtfskR+ngilKKA+ELSvLCdae+a++ifs++gk y y+s
  orange1.1g042438m  9 KRIENKTNRQVTFSKRKNGILKKAFELSVLCDAEIALVIFSPSGKAYHYAS 59
                       79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.085161IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.08E-39272No hitNo description
SuperFamilySSF554553.27E-33276IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGRGKVELKR IENKTNRQVT FSKRKNGILK KAFELSVLCD AEIALVIFSP SGKAYHYASD  60
HHTMDKIIAR YRREVGQLNS ADQRSRLVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A8e-24171169MEF2 CHIMERA
6byy_B8e-24171169MEF2 CHIMERA
6byy_C8e-24171169MEF2 CHIMERA
6byy_D8e-24171169MEF2 CHIMERA
6bz1_A6e-24171169MEF2 CHIMERA
6bz1_B6e-24171169MEF2 CHIMERA
6bz1_C6e-24171169MEF2 CHIMERA
6bz1_D6e-24171169MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the floral meristem at very early stage of the spikelet (rice flower) development. Expressed in lemmas, paleas and lodicules from early to late stage of flower development. {ECO:0000269|PubMed:10945340}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006493218.12e-60truncated transcription factor CAULIFLOWER A-like isoform X3
RefseqXP_024042220.12e-60truncated transcription factor CAULIFLOWER A isoform X1
RefseqXP_024042221.12e-60truncated transcription factor CAULIFLOWER A isoform X2
RefseqXP_024949192.12e-60truncated transcription factor CAULIFLOWER A-like isoform X4
SwissprotQ6Q9I27e-32MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLA0A067FE302e-59A0A067FE30_CITSI; Uncharacterized protein (Fragment)
TrEMBLA0A2H5Q9E75e-59A0A2H5Q9E7_CITUN; Uncharacterized protein
TrEMBLV4TEQ55e-59V4TEQ5_9ROSI; Uncharacterized protein
STRINGXP_006493217.11e-59(Citrus sinensis)
STRINGXP_006436860.18e-60(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.32e-32MIKC_MADS family protein
Publications ? help Back to Top
  1. Cai Q, et al.
    [PAEs in composts of municipal sludge and rice straw].
    Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6
    [PMID:14997664]
  2. Wang K, et al.
    DEP and AFO regulate reproductive habit in rice.
    PLoS Genet., 2010. 6(1): p. e1000818
    [PMID:20107517]
  3. Kobayashi K, et al.
    Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene.
    Plant Cell, 2012. 24(5): p. 1848-59
    [PMID:22570445]
  4. Ramanujam R,Yishi X,Liu H,Naqvi NI
    Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting.
    PLoS ONE, 2012. 7(7): p. e41084
    [PMID:22927898]
  5. Ang TN,Ngoh GC,Chua AS,Lee MG
    Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses.
    Biotechnol Biofuels, 2012. 5(1): p. 67
    [PMID:22958710]
  6. Zhang G,Huang K,Jiang X,Huang D,Yang Y
    Acetylation of rice straw for thermoplastic applications.
    Carbohydr Polym, 2013. 96(1): p. 218-26
    [PMID:23688473]
  7. Wei X, et al.
    Fine mapping of BH1, a gene controlling lemma and palea development in rice.
    Plant Cell Rep., 2013. 32(9): p. 1455-63
    [PMID:23689259]
  8. Hu S, et al.
    A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7.
    Rice (N Y), 2013. 6(1): p. 24
    [PMID:24280027]
  9. Ji Y, et al.
    A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China.
    J. Hazard. Mater., 2014. 279: p. 133-40
    [PMID:25051237]
  10. Huang Y, et al.
    Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai.
    Biomed. Environ. Sci., 2014. 27(10): p. 819-23
    [PMID:25341819]
  11. Tamaki S, et al.
    FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10
    [PMID:25675495]
  12. Wu F, et al.
    The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses.
    Plant J., 2017. 89(2): p. 310-324
    [PMID:27689766]