PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g042156m
Common NameCISIN_1g042156mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 337aa    MW: 37010.6 Da    PI: 9.5196
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g042156mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.14.1e-383595262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       + + +kcprC+s ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+++
  orange1.1g042156m 35 QPQPQKCPRCESLNTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKGKRTK 95
                       56889***************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-323893IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7053993IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-194084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQQQERGGSS EERKQQDRRL KTMQGGTENQ QQQEQPQPQK CPRCESLNTK FCYYNNYSLS  60
QPRYFCKTCR RYWTQGGTLR NVPVGGGCRK GKRTKTSSVS GEASRASQPP QPPSPPHPNL  120
TTTQQNILSS SNPVITTGPP VLRTKLEPAA ASPSMGSYYP SGGFLSSLAA IQSQSFNPQP  180
LHQAFNVGGA DHHHNIGGSS NLDLLQGFST VPSFGSSHTQ HQQIQQSKIY HHQMGNIDKS  240
ANPMHMMYHT IPSDQENLTI QSRRPGSSTS HHQQHDWHQQ GSFINNSNNP NVPDHDTSLW  300
SISTASANSN NTNTASVSGS LNPNQWRDLP GYGPPP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467768.10.0PREDICTED: dof zinc finger protein DOF2.1-like
RefseqXP_006467769.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLA0A067GD590.0A0A067GD59_CITSI; Uncharacterized protein
STRINGPOPTR_0004s04590.11e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15986915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-25TARGET OF MONOPTEROS 6