PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041989m
Common NameCISIN_1g041989mg, LOC102619496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 130aa    MW: 14197.1 Da    PI: 7.8869
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041989mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.41.4e-44121111100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+ rr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++l+e++r++a+ss+vyeA+ar +dPv+G+vg i++lqqq+e+l+a
  orange1.1g041989m  12 PCAACKLIRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELQEHQRSEAVSSMVYEANARFHDPVRGCVGAISSLQQQVESLQA 103
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +lal+++e
  orange1.1g041989m 104 QLALAQAE 111
                        ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.711112IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MESGTRQGAL SPCAACKLIR RRCAQDCVFA PYFPADEPQK FASVHKVFGA SNVNKMLQEL  60
QEHQRSEAVS SMVYEANARF HDPVRGCVGA ISSLQQQVES LQAQLALAQA EVEQMRMRLI  120
SPSSSSSHN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422220.13e-91hypothetical protein CICLE_v10006208mg
RefseqXP_006475321.13e-91PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE99e-59LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A067F2R84e-91A0A067F2R8_CITSI; Uncharacterized protein
TrEMBLV4S9E04e-91V4S9E0_9R
STRINGVIT_19s0027g01120.t019e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-52LOB domain-containing protein 4