PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041581m
Common NameCISIN_1g041581mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 261aa    MW: 30393.4 Da    PI: 9.0312
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041581mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.11.3e-141151343
                       --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
             SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                       ie +  r +t+ kR+ g+ KKAeE S+LC++  ++ii++++
  orange1.1g041581m 11 IEKEKARMITYQKRKRGLKKKAEEFSTLCGVPTCMIIYGPR 51
                       899999*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.297151IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-16151IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-11164IPR002100Transcription factor, MADS-box
CDDcd002662.99E-18250No hitNo description
PRINTSPR004041.3E-7323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-161155IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGRGKLTMQL IEKEKARMIT YQKRKRGLKK KAEEFSTLCG VPTCMIIYGP RLNNRPVDVE  60
IWPKDEKDFM QVVNLYKDKA YSSVRGVKSL SLFDFFADRK RKVDENIAKT RKANYESLFS  120
TDDWDEMINR FSIDQLKQML VVFDEYIDVA TRKLTIMRGQ QQSCIAAADH HRDQALQMIP  180
YNYDLNPVDN PMMMLMMNGG DQMGSSMYNS MQYARCFDPM MGAMINNRLM MMNNPRADVG  240
IFGTTILQPL QHYEQQLPLL P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488665.10.0agamous-like MADS-box protein AGL82
TrEMBLA0A067FZN10.0A0A067FZN1_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006488665.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16227914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.17e-23AGAMOUS-like 82