PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041099m
Common NameCISIN_1g041099mg, LOC102618862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 362aa    MW: 39564.9 Da    PI: 8.1485
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041099mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.75.9e-3949109262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++  lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  orange1.1g041099m  49 QQPPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 109
                        56789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.2E-3352107IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2753107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52553107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MLSNCEKMVV ISSTTNEWPQ NHQIDEKNLM ASTGRVMDKA GQEPPQQQQQ PPLKCPRCDS  60
SNTKFCYYNN YSLSQPRHFC KACKRYWTRG GTLRNVPVGG GCRKNKRVKR PASANNSIDG  120
SNPSAAANPN NPHSQRQIDI SSTSNHINPL FFGLSTNPSD MNLPFSTFNS RVVSSLDTIS  180
GYDLQPQLNA LGLGFSSGLI MSNTDVGDCN YRNGFNPNKQ IQEVVTSSNS LLSSYPTFGS  240
SSSSPTIASL LASSLHQPKF MNGVVKSSTE APNHFNNNLA SFEDLQMTAN NNNNNGEAAR  300
TGMMKEVKAE EGQRRMDWNV ECQNQMEQIG LADPSLYWNS TSSVGAWHDP SNIGSSVTSL  360
I*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.26940.0vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467767.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLA0A067GDE20.0A0A067GDE2_CITSI; Uncharacterized protein
STRINGVIT_10s0003g00040.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-40Dof family protein